1.14.11.30: hypoxia-inducible factor-asparagine dioxygenase

This is an abbreviated version!
For detailed information about hypoxia-inducible factor-asparagine dioxygenase, go to the full flat file.

Word Map on EC 1.14.11.30

Reaction

hypoxia-inducible factor-L-asparagine
+
2-oxoglutarate
+
O2
=
hypoxia-inducible factor-(3S)-3-hydroxy-L-asparagine
+
succinate
+
CO2

Synonyms

asparaginyl hydroxylase, asparaginyl-hydroxylase, factor inhibiting HIF, factor inhibiting HIF-1, factor inhibiting hypoxia inducible factor-1alpha, factor-inhibiting HIF, factor-inhibiting hypoxia-inducible factor, FIH, FIH hydroxylase, HIF asparagine hydroxylase, HIF asparaginyl hydroxylase, HIF hydroxylase, hypoxia-inducible factor asparagine hydroxylase

ECTree

     1 Oxidoreductases
         1.14 Acting on paired donors, with incorporation or reduction of molecular oxygen
             1.14.11 With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
                1.14.11.30 hypoxia-inducible factor-asparagine dioxygenase

KI Value

KI Value on EC 1.14.11.30 - hypoxia-inducible factor-asparagine dioxygenase

Please wait a moment until all data is loaded. This message will disappear when all data is loaded.
Ki VALUE [mM]
INHIBITOR
ORGANISM
UNIPROT
COMMENTARY hide
LITERATURE
IMAGE
0.01
3,4-dihydroxybenzoate
-
pH 7.8, 37°C, Ki-value is determined using soluble extracts of cells expressing enzyme-FLAGHis
0.1
DESGLPQLTSYDCEVNAPIQGSRNLLQGEELLRAL
-
pH 7.8, 37°C, Ki-value is determined using soluble extracts of cells expressing enzyme-FLAGHis
0.16
ESYLLPELTRYDCEVNVPVLGSSTLLQGGDLLRAL
-
pH 7.8, 37°C, Ki-value is determined using soluble extracts of cells expressing enzyme-FLAGHis
0.002
oxalylglycine
-
pH 7.8, 37°C, Ki-value is determined using soluble extracts of cells expressing enzyme-FLAGHis
0.1
PSDLACRLLGQSMDESGLPQLTSYDCEVNAPIQGSRNLLQGEELLRALDQVN
-
pH 7.8, 37°C, Ki-value is determined using soluble extracts of cells expressing enzyme-FLAGHis
-
0.03
Pyridine-2,4-dicarboxylate
-
pH 7.8, 37°C, Ki-value is determined using soluble extracts of cells expressing enzyme-FLAGHis
0.05
Pyridine-2,5-dicarboxylate
-
pH 7.8, 37°C, Ki-value is determined using soluble extracts of cells expressing enzyme-FLAGHis
additional information
additional information
-
the Ki-value for 3-hydroxypyridine-2-carbonylglycine and N-((3-Hydroxy-6-chloroquinolin-2-yl)carbonyl)glycine are above 0.3 mM
-