1.14.11.30: hypoxia-inducible factor-asparagine dioxygenase

This is an abbreviated version!
For detailed information about hypoxia-inducible factor-asparagine dioxygenase, go to the full flat file.

Word Map on EC 1.14.11.30

Reaction

hypoxia-inducible factor-L-asparagine
+
2-oxoglutarate
+
O2
=
hypoxia-inducible factor-(3S)-3-hydroxy-L-asparagine
+
succinate
+
CO2

Synonyms

asparaginyl hydroxylase, asparaginyl-hydroxylase, factor inhibiting HIF, factor inhibiting HIF-1, factor inhibiting hypoxia inducible factor-1alpha, factor-inhibiting HIF, factor-inhibiting hypoxia-inducible factor, FIH, FIH hydroxylase, HIF asparagine hydroxylase, HIF asparaginyl hydroxylase, HIF hydroxylase, hypoxia-inducible factor asparagine hydroxylase

ECTree

     1 Oxidoreductases
         1.14 Acting on paired donors, with incorporation or reduction of molecular oxygen
             1.14.11 With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
                1.14.11.30 hypoxia-inducible factor-asparagine dioxygenase

Substrates Products

Substrates Products on EC 1.14.11.30 - hypoxia-inducible factor-asparagine dioxygenase

Please wait a moment until all data is loaded. This message will disappear when all data is loaded.
SUBSTRATE
PRODUCT                       
REACTION DIAGRAM
ORGANISM
UNIPROT
COMMENTARY
(Substrate) hide
LITERATURE
(Substrate)
COMMENTARY
(Product) hide
LITERATURE
(Product)
Reversibility
r=reversible
ir=irreversible
?=not specified
DESGLPQLTSYDAEVNAPIQGSRNLLQGEELLRALDQVN + 2-oxoglutarate + O2
DESGLPQLTSYDAEV-(3S)-3-hydroxy-L-asparaginyl-APIQGSRNLLQGEELLRALDQVN + succinate + CO2
show the reaction diagram
-
-
-
?
DESGLPQLTSYDCEVNAPI + 2-oxoglutarate + O2
?
show the reaction diagram
-
hypoxia-inducible factor-1alpha peptide 788-806. 9% of the activity obtained with the 35-amino-acid HIF-1alpha peptide DES35 (DESGLPQLTSYDCEVNAPIQGSRNLLQGEELLRAL)
-
-
?
DESGLPQLTSYDCEVNAPIQGSR + 2-oxoglutarate + O2
?
show the reaction diagram
-
hypoxia-inducible factor-1alpha peptide 788-810. 15% of the activity obtained with the 35-amino-acid HIF-1alpha peptide DES35 (DESGLPQLTSYDCEVNAPIQGSRNLLQGEELLRAL)
-
-
?
DESGLPQLTSYDCEVNAPIQGSRNLLQ + 2-oxoglutarate + O2
?
show the reaction diagram
-
hypoxia-inducible factor-1alpha peptide 788-814. 37% of the activity obtained with the 35-amino-acid HIF-1alpha peptide DES35 (DESGLPQLTSYDCEVNAPIQGSRNLLQGEELLRAL)
-
-
?
DESGLPQLTSYDCEVNAPIQGSRNLLQGEEL + 2-oxoglutarate + O2
?
show the reaction diagram
-
hypoxia-inducible factor-1alpha peptide 788-818. 26% of the activity obtained with the 35-amino-acid HIF-1alpha peptide DES35 (DESGLPQLTSYDCEVNAPIQGSRNLLQGEELLRAL)
-
-
?
DESGLPQLTSYDCEVNAPIQGSRNLLQGEELLRAL + 2-oxoglutarate + O2
?
show the reaction diagram
-
hypoxia-inducible factor-1alpha peptide 788-822
-
-
?
ESYLLPELTRYDCEVNVPVLGSSTLLQGGDLLRAL + 2-oxoglutarate + O2
?
show the reaction diagram
-
hypoxia-inducible factor-2alpha peptide 832-857. 7% of the activity obtained with the 35-amino-acid HIF-1alpha peptide DES35 (DESGLPQLTSYDCEVNAPIQGSRNLLQGEELLRAL)
-
-
?
hypoxia-inducible factor-L-asparagine + 2-oxoglutarate + O2
hypoxia-inducible factor-(3S)-3-hydroxy-L-asparagine + succinate + CO2
show the reaction diagram
hypoxia-inducible factor-L-asparagine peptide + 2-oxoglutarate + O2
hypoxia-inducible factor-(3S)-3-hydroxy-L-asparagine peptide + succinate + CO2
show the reaction diagram
-
39-residue peptide corresponding to HIF-1alpha788-826 mutant C800A
hydroxylation at Asn803
-
?
hypoxia-inducible factor1alpha C-terminal oxygen dependent degradation domain-L-proline + 2-oxoglutarate + O2
hypoxia-inducible factor1alpha C-terminal oxygen dependent degradation domain-trans-4-hydroxy-L-proline + succinate + CO2
show the reaction diagram
-
-
-
-
?
hypoxia-inducible factor1alpha N-terminal oxygen dependent degradation domain-L-proline + 2-oxoglutarate + O2
hypoxia-inducible factor1alpha N-terminal oxygen dependent degradation domain-trans-4-hydroxy-L-proline + succinate + CO2
show the reaction diagram
-
-
-
-
?
hypoxia-inducible factor2alpha C-terminal oxygen dependent degradation domain-L-proline + 2-oxoglutarate + O2
hypoxia-inducible factor2alpha C-terminal oxygen dependent degradation domain-trans-4-hydroxy-L-proline + succinate + CO2
show the reaction diagram
-
-
-
-
?
hypoxia-inducible factor2alpha N-terminal oxygen dependent degradation domain-L-proline + 2-oxoglutarate + O2
hypoxia-inducible factor2alpha N-terminal oxygen dependent degradation domain-trans-4-hydroxy-L-proline + succinate + CO2
show the reaction diagram
-
-
-
-
?
LTRYDCEVNVPVLGSSTLL + O2
?
show the reaction diagram
-
hypoxia-inducible factor-2alpha peptide 839-866. 1% of the activity obtained with the 35-amino-acid HIF-1alpha peptide DES35 (DESGLPQLTSYDCEVNAPIQGSRNLLQGEELLRAL)
-
-
?
LTSYDCEVNAPIQGSRNLL + 2-oxoglutarate + O2
?
show the reaction diagram
-
hypoxia-inducible factor-1alpha peptide 795-813. 4% of the activity obtained with the 35-amino-acid HIF-1alpha peptide DES35 (DESGLPQLTSYDCEVNAPIQGSRNLLQGEELLRAL)
-
-
?
PSDLACRLLGQSMDESGLPQLTSYDCEVNAPIQGSRNLLQGEELLRALDQVN + 2-oxoglutarate + O2
?
show the reaction diagram
rabankyrin-5 + 2-oxoglutarate + O2
trihydroxy-rabankyrin-5 + succinate + CO2
show the reaction diagram
-
hydroxylation at N316, N485 and N649
-
-
?
TRPV3 channel ankyrin repeat domain + 2-oxoglutarate + O2
?
show the reaction diagram
-
-
-
-
?
additional information
?
-
-
the subtrate contains a C-terminal and a N-terminal oxygen-dependent degradation domain, as well as a C-terminal transactivation domain
-
-
-