Sequence of BIOF_GEOKA

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
8-amino-7-oxononanoate synthase
Q5KY23
Geobacillus kaustophilus (strain HTA426)
390
42524
Reaction
pimeloyl-[acyl-carrier protein] + L-alanine = 8-amino-7-oxononanoate + CO2 + holo-[acyl-carrier protein]
Sequences with same EC No.
Sequence
show sequence in normal format
>Q5KY23|8-amino-7-oxononanoate synthase|EC 2.3.1.47|Geobacillus kaustophilus (strain HTA426)|Swiss-Prot
MKTELTVKLHEWEQKAQKRQLRRAEASGATVILNGKPMLNLASNNYLGLADDRRLIEAGC
EAMRAYGAGAGASRLVVGNHPLYERAEAALKQWKKAEAALIFNSGYTANIGVLTALIGRD
DLVFSDKLNHASLIDGIRLSKAACFRYRHHDIDQLESLLKQSPPAKRKWIVTDAVFSMDG
DMAPLEELVELKRRYRAVLLVDEAHSGGVFGPNGEGLLHHFGLEKEEDVIAIGTFSKALG
SFGAYVTGEPWLVDYLINSARSLIFTTALPPSVLAANEAAIHIVQAEPKRRERLHALSER
FRTKLKRLGFDTGGSETPIVPVIVGPNDRAVAMSEQLQEAGIAAVAIRPPTVPEGTARIR
FSITAAMTEEDIDMAVDCIALAGKRIGLIS
Download this sequence
in fasta format
Download all sequences for 2.3.1.47
in fasta format
in csv (Excel, OpenOffice) format
Sequence related references
Sequence Reference
Authors
Title
Journal
Volume
Pages
Year
PubMed ID
505053
Takami H.,Takaki Y.,Chee G.-J.,Nishi S.,Shimamura S.,Suzuki H.,Matsui S.,Uchiyama I.
Thermoadaptation trait revealed by the genome sequence of thermophilic Geobacillus kaustophilus.
Nucleic Acids Res.
32
6292-6303
2004