Sequence of AOX1B_ORYSJ

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
ubiquinol oxidase (non-electrogenic)
O82766
Oryza sativa subsp. japonica
335
37251
Reaction
2 ubiquinol + O2 = 2 ubiquinone + 2 H2O
Sequences with same EC No.
Sequence
show sequence in normal format
>O82766|ubiquinol oxidase (non-electrogenic)|EC 1.10.3.11|Oryza sativa subsp. japonica|Swiss-Prot
MSSRMAGATLLRHLGPRLFAAEPVYSGLAASARGVMPAAARIFPARMASTSSAGADVKEG
AAEKLPEPAATAAAAATDPQNKKAVVSYWGIQPPKLVKEDGTEWKWLSFRPWDTYTSDTS
IDVTKHHEPKGLPDKLAYWTVRSLAVPRDLFFQRRHASHALLLETVAGVPGMVGGMLLHL
RSLRRFEQSGGWIRALLEEAENERMHLMTFLEVMQPRWWERALVLAAQGVFFNAYFVGYL
VSPKFAHRFVGYLEEEAVSSYTEYLKDLEAGKIENTPAPAIAIDYWRLPADATLKDVVTV
IRADEAHHRDLNHFASDIQQQGMKLKDTPAPIGYH
Download this sequence
in fasta format
Download all sequences for 1.10.3.11
in fasta format
in csv (Excel, OpenOffice) format
Sequence related references
Sequence Reference
Authors
Title
Journal
Volume
Pages
Year
PubMed ID
506027
Ito Y.,Saisho D.,Nakazono M.,Tsutsumi N.,Hirai A.
Transcript levels of tandem-arranged alternative oxidase genes in rice are increased by low temperature.
Gene
203
121-129
1997
506028
Feng Q.,Zhang Y.,Hao P.,Wang S.,Fu G.,Huang Y.,Li Y.,Zhu J.,Liu Y.,Hu X.,Jia P.,Zhang Y.,Zhao Q.,Ying K.,Yu S.,Tang Y.,Weng Q.,Zhang L.,Lu Y.,Mu J.,Lu Y.,Zhang L.S.,Yu Z.,Fan D.,Liu X.,Lu T.,Li C.,Wu Y.,Sun T.,Lei H.,Li T.,Hu H.,Guan J.,Wu M.,Zhang R.,Zhou B.,Chen Z.,Chen L.,Jin Z.,Wang R.,Yin H.,Cai Z.,Ren S.,Lv G.,Gu W.,Zhu G.,Tu Y.,Jia J.,Zhang Y.,Chen J.,Kang H.,Chen X.,Shao C.,Sun Y.,Hu Q.,Zhang X.,Zhang W.,Wang L.,Ding C.,Sheng H.,Gu J.,Chen S.,Ni L.,Zhu F.,Chen W.,Lan L.,Lai Y.,Cheng Z.,Gu M.,Jiang J.,Li J.,Hong G.,Xue Y.,Han B.
Sequence and analysis of rice chromosome 4.
Nature
420
316-320
2002
506029
The map-based sequence of the rice genome.
Nature
436
793-800
2005
506030
The rice annotation project database (RAP-DB): 2008 update.
Nucleic Acids Res.
36
0-0
2008
506031
Kawahara Y.,de la Bastide M.,Hamilton J.P.,Kanamori H.,McCombie W.R.,Ouyang S.,Schwartz D.C.,Tanaka T.,Wu J.,Zhou S.,Childs K.L.,Davidson R.M.,Lin H.,Quesada-Ocampo L.,Vaillancourt B.,Sakai H.,Lee S.S.,Kim J.,Numa H.,Itoh T.,Buell C.R.,Matsumoto T.
Improvement of the Oryza sativa Nipponbare reference genome using next generation sequence and optical map data.
Rice
6
4-4
2013
506032
Yu J.,Wang J.,Lin W.,Li S.,Li H.,Zhou J.,Ni P.,Dong W.,Hu S.,Zeng C.,Zhang J.,Zhang Y.,Li R.,Xu Z.,Li S.,Li X.,Zheng H.,Cong L.,Lin L.,Yin J.,Geng J.,Li G.,Shi J.,Liu J.,Lv H.,Li J.,Wang J.,Deng Y.,Ran L.,Shi X.,Wang X.,Wu Q.,Li C.,Ren X.,Wang J.,Wang X.,Li D.,Liu D.,Zhang X.,Ji Z.,Zhao W.,Sun Y.,Zhang Z.,Bao J.,Han Y.,Dong L.,Ji J.,Chen P.,Wu S.,Liu J.,Xiao Y.,Bu D.,Tan J.,Yang L.,Ye C.,Zhang J.,Xu J.,Zhou Y.,Yu Y.,Zhang B.,Zhuang S.,Wei H.,Liu B.,Lei M.,Yu H.,Li Y.,Xu H.,Wei S.,He X.,Fang L.,Zhang Z.,Zhang Y.,Huang X.,Su Z.,Tong W.,Li J.,Tong Z.,Li S.,Ye J.,Wang L.,Fang L.,Lei T.,Chen C.-S.,Chen H.-C.,Xu Z.,Li H.,Huang H.,Zhang F.,Xu H.,Li N.,Zhao C.,Li S.,Dong L.,Huang Y.,Li L.,Xi Y.,Qi Q.,Li W.,Zhang B.,Hu W.,Zhang Y.,Tian X.,Jiao Y.,Liang X.,Jin J.,Gao L.,Zheng W.,Hao B.,Liu S.-M.,Wang W.,Yuan L.,Cao M.,McDermott J.,Samudrala R.,Wang J.,Wong G.K.-S.,Yang H.
The genomes of Oryza sativa: a history of duplications.
PLoS Biol.
3
266-281
2005
506033
Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
Science
301
376-379
2003
506034
Li C.R.,Liang D.D.,Li J.,Duan Y.B.,Li H.,Yang Y.C.,Qin R.Y.,Li L.,Wei P.C.,Yang J.B.
Unravelling mitochondrial retrograde regulation in the abiotic stress induction of rice ALTERNATIVE OXIDASE 1 genes.
Plant Cell Environ.
36
775-788
2013