Sequence of BIOF_GEOUR

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
8-amino-7-oxononanoate synthase
A5G6I9
Geobacter uraniireducens (strain Rf4)
391
41490
Reaction
pimeloyl-[acyl-carrier protein] + L-alanine = 8-amino-7-oxononanoate + CO2 + holo-[acyl-carrier protein]
Sequences with same EC No.
Sequence
show sequence in normal format
>A5G6I9|8-amino-7-oxononanoate synthase|EC 2.3.1.47|Geobacter uraniireducens (strain Rf4)|Swiss-Prot
MQTFAEELAALRMEGLFRSMRLVEGNQSKRAVLDGREVLLLCSNNYLGLADHPLLKEAAI
RAVERYGVGSGASRLVSGTMELHEALEARIAAFKGTNSALVFNSGYAANTGIISAIAGRG
DVIFSDRLNHASIVDGALLSRARFVRYPHNNISVLRRLLEDTEVASGRRLIVTDGVFSMD
GDLAKLSELVALKKEFDALLMVDDAHGTGVLGDGGRGSAEQCGVMAEVDIHMGTLGKALG
SFGAYAAASREIIDYLVNRARSFIFSTSLPPAVLAASQAAFELVDSPSGAALRLALAANT
IRFKAGLQAVGFDTMGSETQIVPVYVGGAQQTMEFSRLLLEEGVFVQGIRPPTVPAGSCR
LRCTLMATHSENDLDQAITAITAIGEKLGVI
Download this sequence
in fasta format
Download all sequences for 2.3.1.47
in fasta format
in csv (Excel, OpenOffice) format