Sequence of A0A2U3K712_9FIRM

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
pyrimidine-nucleoside phosphorylase
A0A2U3K712
Candidatus Desulfosporosinus infrequens
436
46379
Reaction
2'-deoxyuridine + phosphate = uracil + 2-deoxy-alpha-D-ribose 1-phosphate
Sequences with same EC No.
Sequence
show sequence in normal format
>A0A2U3K712|pyrimidine-nucleoside phosphorylase|EC 2.4.2.2|Candidatus Desulfosporosinus infrequens|TrEMBL
MIHMRMVDLLEKKRDGKSLSKEEICFTIEGYVQGTIPDYQMAAWAMAVFFRGMSLEETTE
LTLAMAQSGNQLDLSSLGGRFVDKHSTGGVGDKTTLLVGPMVAACGVPVAKMSGRGLGHT
GGTIDKLSSVPGFRVELTQEEFLAQVKKIGLSVIAQTGNLVPADKKLYALRDVTATVNSI
PLIASSVMSKKIAAGAQGIVLDVKYGSGAFMKTVDEARILAKTMVDIGKALGRQTIAVLS
NMNQPLGRAVGNSLEILEVADALQGKGSPDLVEVSLELGAWMLVAGEIVSKVETGKERLR
QSLASGAAWNKFLAFLTEQGGDAQAVVDRRLRIASWSLPILAQETGYVQLFDAQKIGILA
MVLGAGRVTKDSSIDLGTGVILVKKAGEWVEAGEPILQLYGSNQEMLTEGLKLAQNLVAV
GREAPKLPPLIEEVIL
Download this sequence
in fasta format
Download all sequences for 2.4.2.2
in fasta format
in csv (Excel, OpenOffice) format