Any feedback?
Please rate this page
(sequences.php)
(0/150)

BRENDA support

Sequence of PQQC_ACIB3

EC Number:1.3.3.11

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
pyrroloquinoline-quinone synthase
B7H2Y2
Acinetobacter baumannii (strain AB307-0294)
252
29665
Reaction
6-(2-amino-2-carboxyethyl)-7,8-dioxo-1,2,3,4,7,8-hexahydroquinoline-2,4-dicarboxylate + 3 O2 = 4,5-dioxo-4,5-dihydro-1H-pyrrolo[2,3-f]quinoline-2,7,9-tricarboxylate + 2 H2O2 + 2 H2O
Other sequences found for EC No. 1.3.3.11

General information:

Sequence
show sequence in normal format
>B7H2Y2|pyrroloquinoline-quinone synthase|EC 1.3.3.11|Acinetobacter baumannii (strain AB307-0294)|Swiss-Prot
MTQTPEALTTEQFKQAIIDKGQYYHIYHPFHVMMYEGKATQQQIQAWVANRYYYQINIPL
KDAAIMANCPDQRVRQEWIQRMIDQDGEYPDGGGREAWLRLAEAVGLSREQVISEELVLP
GVRFAVDAYVNFARRASWREAASSSLTELFAPQIHQSRLESWPQHYPWIDDKGYEYFRSR
LSQARRDVEHGLTITLDSFTTHEQQQRMLEILQFKLDILWSILDALTLAYVHNEAPYHSV
TQERVWHKGLFK
Download this sequence
in fasta format
Download all sequences for 1.3.3.11
in fasta format
in csv (Excel, OpenOffice) format
Sequence related references
Sequence Reference
Authors
Title
Journal
Volume
Pages
Year
PubMed ID
589517
Adams M.D.,Goglin K.,Molyneaux N.,Hujer K.M.,Lavender H.,Jamison J.J.,MacDonald I.J.,Martin K.M.,Russo T.,Campagnari A.A.,Hujer A.M.,Bonomo R.A.,Gill S.R.
Comparative genome sequence analysis of multidrug-resistant Acinetobacter baumannii.
J. Bacteriol.
190
8053-8064
2008