Any feedback?
Please rate this page
(sequences.php)
(0/150)

BRENDA support

Sequence of B5D5P4_CRAGI

EC Number:1.5.1.17

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
alanopine dehydrogenase
B5D5P4
Crassostrea gigas
408
45433
Reaction
2,2'-iminodipropanoate + NAD+ + H2O = L-alanine + pyruvate + NADH + H+
Other sequences found for EC No. 1.5.1.17

General information:

Sequence
show sequence in normal format
>B5D5P4|alanopine dehydrogenase|EC 1.5.1.17|Crassostrea gigas|TrEMBL
MDGKLVVLTCGGGNGAHCLAGLSAMRPKIESRVLTLYSDEAERWAVELDSGLLITVRNDD
GSKSLIKTKPSMVTKDPQKAVPGANYIFFVVPAFAHAQYLEAIAPYIEGNTVIVGLPSHA
GFEFECADLLGEKANACTIVAFESLPFVCRLIEFGKNVEILGFKDTLGASTLKGKRCNVT
QSVLELPQYIFGDRPKVRRVQNYITTILMAKFIVHPSLMYGKWSQWDGRPLSEKPLFYQG
IDKRQAELLSGVSDECVATAKAIEKMVPGLDMSDVIHVFDWYLNYYGEQISDKSNLMTAM
RTNKAYDGLDQPMKEIEPGKYVPDFTYRYLSEDVPMGIVPMKGIAELAGVSTPFLDEVIT
WCQSKLNKEFLVGNKLTGKDLKDTRSPQKYGYNKLEDLFSGNLNSFRY
Download this sequence
in fasta format
Download all sequences for 1.5.1.17
in fasta format
in csv (Excel, OpenOffice) format