Any feedback?
Please rate this page
(sequences.php)
(0/150)

BRENDA support

Sequence of B9RHX9_RICCO

EC Number:1.14.14.102

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
N-methylcoclaurine 3'-monooxygenase
B9RHX9
Ricinus communis
426
47866
Reaction
(S)-N-methylcoclaurine + [reduced NADPH-hemoprotein reductase] + O2 = (S)-3'-hydroxy-N-methylcoclaurine + [oxidized NADPH-hemoprotein reductase] + H2O
Other sequences found for EC No. 1.14.14.102

General information:

Sequence
show sequence in normal format
>B9RHX9|N-methylcoclaurine 3'-monooxygenase|EC 1.14.14.102|Ricinus communis|TrEMBL
MDTAFSGVLGILSLSFLLLLPLIFIILNHISSPSSERRPLPPGPRQWPIVGNILQVGKKP
HVSLAYFAKLHGPLISLRLGAQIVVVASSPIAAAEILKTHDRLLSARFISAANPYGDHVL
DRVALVWNPSFGDQGNAGGLKTLITKLMQLATAPNIADFYPVLARLDPQNMRRKMKIGFE
KVLNAWQIYIKERRENHVNDAPETDFLDVFLSTGFDDDQINWLVLELFAAGVDTTTTTVE
WAMAELLKSRATLVKVQQELDREVDNKSIEESHVLQLQYLNACIKETFRLHPPAPFLIPR
RALNTCEVLNYTIPKNSQVVVNLWAIGRDSSSWEDPLSFKPERFLNSNIDFKGHHFQLLP
FGSGRRTCPGLPMATRQLPLILAYLIRCFEWSLPNDQDPAMLDMNDKFGITLVKDSPLLL
VPKRKL
Download this sequence
in fasta format
Download all sequences for 1.14.14.102
in fasta format
in csv (Excel, OpenOffice) format
Sequence related references
Sequence Reference
Authors
Title
Journal
Volume
Pages
Year
PubMed ID
99116242
Chan A.P.,Crabtree J.,Zhao Q.,Lorenzi H.,Orvis J.,Puiu D.,Melake-Berhan A.,Jones K.M.,Redman J.,Chen G.,Cahoon E.B.,Gedil M.,Stanke M.,Haas B.J.,Wortman J.R.,Fraser-Liggett C.M.,Ravel J.,Rabinowicz P.D.
Draft genome sequence of the oilseed species Ricinus communis.
Nat. Biotechnol.
28
951-956
2010