Sequence of ASO_TOBAC

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
L-ascorbate oxidase
Q40588
Nicotiana tabacum
578
64865
Reaction
4 L-ascorbate + O2 = 4 monodehydroascorbate + 2 H2O
Sequences with same EC No.
Sequence
show sequence in normal format
>Q40588|L-ascorbate oxidase|EC 1.10.3.3|Nicotiana tabacum|Swiss-Prot
MASLGFLFFFLLPLILLELSSSRSVMAAKTRHFKWDVEYIHWSPDGEESVVMGINGQFPG
PTIRAKAGDTVAVHLTNKLHTEGVVIHWHGIRQIGTPWADGTAAISQCAINPGETFLYRF
KVDKAGTYFYHGHYGMQRSAGLYGSLIVEVGEGEKEPFHYDGEFNLLLSDWWHKGSHEQE
VDLSSNPLRWIGEPQTLLLNGRGQYNCSLAARFSKPPLPQCKLRGGEQYAPQILRVRPNK
IYRLRVASTTALGSLSLAIGGHKMVVVEADGNYVQPFSVQDMDIYSGESYSVLFKTDQDP
TKNYWISINVRGREPKTPQGLTLLNYLPNSASKFPTLPPPIAPLWNDYNHSKSFSNKIFA
LMGSPKPPPQNHRRIILLNTQNKIDGYTKWAINNVSLVLPTQLYLGSIRYGINAFDTKPP
PDNFPKDYDVLKQAPNSNSTYGNGVYMLKFNTTIDIILQNANALAKDVSEIHPWHLHGHD
FWVLGYGEGKFSEKDVKKFNLKNPPLRNTAVIFPFGWTALRFVTDNPGVWAFHCHIEPHL
HMGMGVIFAEGVHLVKKIPKEALACGLTGKMLMSNKHN
Download this sequence
in fasta format
Download all sequences for 1.10.3.3
in fasta format
in csv (Excel, OpenOffice) format
Sequence related references
Sequence Reference
Authors
Title
Journal
Volume
Pages
Year
PubMed ID
632123
Kato N.,Esaka M.
cDNA cloning and gene expression of ascorbate oxidase in tobacco.
Plant Mol. Biol.
30
833-837
1996