Sequence of TPDR2_COMSP

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
terephthalate 1,2-dioxygenase
Q3C1D2
Comamonas sp
336
36340
Reaction
terephthalate + NADH + H+ + O2 = (1R,6S)-dihydroxycyclohexa-2,4-diene-1,4-dicarboxylate + NAD+
Sequences with same EC No.
Sequence
show sequence in normal format
>Q3C1D2|terephthalate 1,2-dioxygenase|EC 1.14.12.15|Comamonas sp|Swiss-Prot
MNHQIHIHDSDIAFPCAPGQSVLDAALQAGIELPYSCRKGSCGNCASTLLDGNIASFNGM
AVRNELCASEQVLLCGCTAASDIRIHPSSFRRLDPEARKRFTAKVYSNTLAAPDVSLLRL
RLPVGKRAKFEAGQYLLIHLDDGESRSYSMANPPHESDGITLHVRHVPGGRFSTIVQQLK
SGDTLDIELPFGSIALKPDDARPLICVAGGTGFAPIKSVLDDLAKRKVQRDITLIWGARN
PSGLYLPSAIDKWRKVWPQFRYIAAITDLGDMPADAHAGRVDDALRTHFGNLHDHVVHCC
GSPALVQSVRTAASDMGLLAQDFHADVFATGPTGHH
Download this sequence
in fasta format
Download all sequences for 1.14.12.15
in fasta format
in csv (Excel, OpenOffice) format
Sequence related references
Sequence Reference
Authors
Title
Journal
Volume
Pages
Year
PubMed ID
713483
Sasoh M.,Masai E.,Ishibashi S.,Hara H.,Kamimura N.,Miyauchi K.,Fukuda M.
Characterization of the terephthalate degradation genes of Comamonas sp. strain E6.
Appl. Environ. Microbiol.
72
1825-1832
2006
713484
Fukuhara Y.,Kasai D.,Katayama Y.,Fukuda M.,Masai E.
Enzymatic properties of terephthalate 1,2-dioxygenase of Comamonas sp. strain E6.
Biosci. Biotechnol. Biochem.
72
2335-2341
2008