Any feedback?
Please rate this page
(sequences.php)
(0/150)

BRENDA support

Sequence of PRXC_LEPFU

EC Number:1.11.1.10

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
chloride peroxidase
P04963
Leptoxyphium fumago
373
40504
Reaction
RH + chloride + H2O2 = RCl + 2 H2O
Other sequences found for EC No. 1.11.1.10

General information:

Sequence
show sequence in normal format
>P04963|chloride peroxidase|EC 1.11.1.10|Leptoxyphium fumago|Swiss-Prot
MFSKVLPFVGAVAALPHSVRQEPGSGIGYPYDNNTLPYVAPGPTDSRAPCPALNALANHG
YIPHDGRAISRETLQNAFLNHMGIANSVIELALTNAFVVCEYVTGSDCGDSLVNLTLLAE
PHAFEHDHSFSRKDYKQGVANSNDFIDNRNFDAETFQTSLDVVAGKTHFDYADMNEIRLQ
RESLSNELDFPGWFTESKPIQNVESGFIFALVSDFNLPDNDENPLVRIDWWKYWFTNESF
PYHLGWHPPSPAREIEFVTSASSAVLAASVTSTPSSLPSGAIGPGAEAVPLSFASTMTPF
LLATNAPYYAQDPTLGPNDKREAAPAATTSMAVFKNPYLEAIGTQDIKNQQAYVSSKAAA
MASAMAANKARNL
Download this sequence
in fasta format
Download all sequences for 1.11.1.10
in fasta format
in csv (Excel, OpenOffice) format
Sequence related references
Sequence Reference
Authors
Title
Journal
Volume
Pages
Year
PubMed ID
844776
Fang G.-H.,Kenigsberg P.,Axley M.J.,Nuell M.,Hager L.P.
Cloning and sequencing of chloroperoxidase cDNA.
Nucleic Acids Res.
14
8061-8071
1986
844777
Nuell M.J.,Fang G.-H.,Axley M.J.,Kenigsberg P.,Hager L.P.
Isolation and nucleotide sequence of the chloroperoxidase gene from Caldariomyces fumago.
J. Bacteriol.
170
1007-1011
1988
844778
Conesa A.,an de Velde F.,van Rantwijk F.,Sheldon R.A.,van den Hondel C.A.M.J.J.,Punt P.J.
Expression of the Caldariomyces fumago Chloroperoxidase in Aspergillus niger and characterization of the recombinant enzyme.
J. Biol. Chem.
276
17635-17640
2001
844779
Axley M.J.,Kenigsberg P.,Hager L.P.
Fructose induces and glucose represses chloroperoxidase mRNA levels.
J. Biol. Chem.
261
15058-15061
1986
844781
Blanke S.R.,Hager L.P.
Identification of the fifth axial heme ligand of chloroperoxidase.
J. Biol. Chem.
263
18739-18743
1988
844782
Yi X.,Mroczko M.,Manoj K.M.,Wang X.,Hager L.P.
Replacement of the proximal heme thiolate ligand in chloroperoxidase with a histidine residue.
Proc. Natl. Acad. Sci. U.S.A.
96
12412-12417
1999
844783
Sundaramoorthy M.,Terner J.,Poulos T.L.
The crystal structure of chloroperoxidase: a heme peroxidase-cytochrome P450 functional hybrid.
Structure
3
1367-1377
1995