Sequence of TYTR_TRYCR

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
trypanothione-disulfide reductase
P28593
Trypanosoma cruzi
492
53868
Reaction
trypanothione + NADP+ = trypanothione disulfide + NADPH + H+
Sequences with same EC No.
Sequence
show sequence in normal format
>P28593|trypanothione-disulfide reductase|EC 1.8.1.12|Trypanosoma cruzi|Swiss-Prot
MMSKIFDLVVIGAGSGGLEAAWNAATLYKKRVAVIDVQMVHGPPFFSALGGTCVNVGCVP
KKLMVTGAQYMEHLRESAGFGWEFDRTTLRAEWKKLIAVKDEAVLNINKSYEEMFRDTEG
LEFFLGWGSLESKNVVNVRESADPASAVKERLETENILLASGSWPHMPNIPGIEHCISSN
EAFYLPEPPRRVLTVGGGFISVEFAGIFNAYKPKDGQVTLCYRGEMILRGFDHTLREELT
KQLTANGIQILTKENPAKVELNADGSKSVTFESGKKMDFDLVMMAIGRSPRTKDLQLQNA
GVMIKNGGVQVDEYSRTNVSNIYAIGDVTNRVMLTPVAINEAAALVDTVFGTNPRKTDHT
RVASAVFSIPPIGTCGLIEEVASKRYEVVAVYLSSFTPLMHNISGSKYKTFVAKIITNHS
DGTVLGVHLLGDNAPEIIQGVGICLKLNAKISDFYNTIGVHPTSAEELCSMRTPSYYYVK
GEKMEKPSEASL
Download this sequence
in fasta format
Download all sequences for 1.8.1.12
in fasta format
in csv (Excel, OpenOffice) format
Sequence related references
Sequence Reference
Authors
Title
Journal
Volume
Pages
Year
PubMed ID
843274
Sullivan F.X.,Walsh C.T.
Cloning, sequencing, overproduction and purification of trypanothione reductase from Trypanosoma cruzi.
Mol. Biochem. Parasitol.
44
145-148
1991
843275
Borges A.,Cunningham M.L.,Tover J.,Fairlamb A.H.
Site-directed mutagenesis of the redox-active cysteines of Trypanosoma cruzi trypanothione reductase.
Eur. J. Biochem.
228
745-752
1995
843276
Krauth-Siegel R.L.,Sticherling C.,Jost I.,Walsh C.T.,Pai E.F.,Kabsch W.,Lantwin C.B.
Crystallization and preliminary crystallographic analysis of trypanothione reductase from Trypanosoma cruzi, the causative agent of Chagas' disease.
FEBS Lett.
317
105-108
1993
843277
Lantwin C.B.,Schlichting I.,Kabsch W.,Pai E.F.,Krauth-Siegel R.L.
The structure of Trypanosoma cruzi trypanothione reductase in the oxidized and NADPH reduced state.
Proteins
18
161-173
1994
843278
Zhang Y.,Bond C.S.,Bailey S.,Cunningham M.L.,Fairlamb A.H.,Hunter W.N.
The crystal structure of trypanothione reductase from the human pathogen Trypanosoma cruzi at 2.3-A resolution.
Protein Sci.
5
52-61
1996