Any feedback?
Please rate this page
(sequences.php)
(0/150)

BRENDA support

Sequence of A0A5E4HQH6_9ARCH

EC Number:1.16.1.10

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
ferric-chelate reductase [NAD(P)H]
A0A5E4HQH6
uncultured archaeon
198
21919
Reaction
2 Fe(II)-siderophore + NAD(P)+ + H+ = 2 Fe(III)-siderophore + NAD(P)H
Other sequences found for EC No. 1.16.1.10

General information:

Sequence
show sequence in normal format
>A0A5E4HQH6|ferric-chelate reductase [NAD(P)H]|EC 1.16.1.10|uncultured archaeon|TrEMBL
MAITKKSLGPKAVVFPTPVFVVGTYDKLGRPNVMTAAWGGICCSSPPAVCVSLRKATYSY
RNILEKKAFTVNIPSEELMKEADFFGLTSGRDVDKFSAAGIKPVRSDLVDAPYIQEFPLT
LECKLVNFTDLGLHTQFVGEVMDVKADERIMEKGKLSIEKIKPLVFDPEAGRYYALGKYV
GKAFKTGEIFSMPRDKME
Download this sequence
in fasta format
Download all sequences for 1.16.1.10
in fasta format
in csv (Excel, OpenOffice) format