Any feedback?
Please rate this page
(sequences.php)
(0/150)

BRENDA support

Sequence of A0A2P6QKV9_ROSCH

EC Number:1.14.14.105

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
taxane 10beta-hydroxylase
A0A2P6QKV9
Rosa chinensis
132
14309
Reaction
taxa-4(20),11-dien-5alpha-yl acetate + [reduced NADPH-hemoprotein reductase] + O2 = 10beta-hydroxytaxa-4(20),11-dien-5alpha-yl acetate + [oxidized NADPH-hemoprotein reductase] + H2O
Other sequences found for EC No. 1.14.14.105

General information:

Sequence
show sequence in normal format
>A0A2P6QKV9|taxane 10beta-hydroxylase|EC 1.14.14.105|Rosa chinensis|TrEMBL
MGSPTVIVIGQEGNKFILGAEDDVLAAKQPPTLLAIGGKQSIFELTGSWYRLVKGAMVSF
LKPESLQNYINQMDKLIKTMLLKETENKDTIKAVVTMKKLTFNIASSILFGIKDENTGGG
GGGGWSCLRTFH
Download this sequence
in fasta format
Download all sequences for 1.14.14.105
in fasta format
in csv (Excel, OpenOffice) format