Sequence of A0A090SD17_9VIBR

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
2-methylacyl-CoA dehydrogenase
A0A090SD17
Vibrio maritimus
385
42151
Reaction
2-methylbutanoyl-CoA + acceptor = 2-methylbut-2-enoyl-CoA + reduced acceptor
Sequences with same EC No.
Sequence
show sequence in normal format
>A0A090SD17|2-methylacyl-CoA dehydrogenase|EC 1.3.99.12|Vibrio maritimus|TrEMBL
MMDFELNEDQRAFADTASQFATESLLPNAAKWDEECHFPKDVLRQAGDIGFLSLYTPEEQ
GGLGLSRLDASIVFEQLSMGCTSTTAFMTIHNMVTWMVASFADDAARQRFVPKLISGEWL
GSYCLTEPNAGSDAASLTTNASLEGGYYVLNGAKTFISGAGDTEVLLVMARTGEVGAKGI
SAFVLDADSEGISFGRKEPKMGWNSQPTRAITFENVKVPVNQLLGREGEGFTFAMKGLDG
GRINIATCSVGTAQHALNQATQYLQERKQFGQPLASFQALQFKLADLATELVAARQMVRL
AAFKLDAGHADATTYCAMAKRYATDVGFKVCDGVLQLFGGYGYIKEYSLERHFRDVRVHQ
ILEGTNEIMRLIIARRLLNNSYPIE
Download this sequence
in fasta format
Download all sequences for 1.3.99.12
in fasta format
in csv (Excel, OpenOffice) format