Any feedback?
Please rate this page
(sequences.php)
(0/150)

BRENDA support

Sequence of MENJ_MYCS2

EC Number:1.3.99.38

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
menaquinone-9 beta-reductase
A0QRI8
Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
409
43404
Reaction
menaquinone-9 + reduced acceptor = beta-dihydromenaquinone-9 + acceptor
Other sequences found for EC No. 1.3.99.38

General information:

Sequence
show sequence in normal format
>A0QRI8|menaquinone-9 beta-reductase|EC 1.3.99.38|Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)|Swiss-Prot
MNTRADVVVVGAGPAGSAAAAWAARAGRDVVVVDAAQFPRDKACGDGLTPRAVAELQRLG
MASWLDTRIRHHGLRMSGFGADVEIPWPGPSFPATSSAVPRTELDDRIRSVAADDGAKMM
LGTKVVDVTHDSSGRVDAVVLDDGNTVGCAQLIVADGARSTLGRVLGRTWHRETVYGVAI
RGYIASPRASEPWITSHLELRSPEGKVLPGYGWMFPLGNGEVNIGVGALATAKRPADAAL
RPLMSYYADLRREEWGLVGEPRAGLSALLPMGGAVSGVAGPNWMLIGDAAACVNPLNGEG
IDYGLETGRLAAELMTSGGVTDYSSAWPTLLQEHYARGFSVARRLALLLTLPRFLQVTGP
VAMRSATLMTIAVRVMGNLVTDEDADWIARVWRTAGLASRRIDQRVPFS
Download this sequence
in fasta format
Download all sequences for 1.3.99.38
in fasta format
in csv (Excel, OpenOffice) format
Sequence related references
Sequence Reference
Authors
Title
Journal
Volume
Pages
Year
PubMed ID
953299
Deshayes C.,Perrodou E.,Gallien S.,Euphrasie D.,Schaeffer C.,Van-Dorsselaer A.,Poch O.,Lecompte O.,Reyrat J.-M.
Interrupted coding sequences in Mycobacterium smegmatis: authentic mutations or sequencing errors?
Genome Biol.
8
0-0
2007
953300
Gallien S.,Perrodou E.,Carapito C.,Deshayes C.,Reyrat J.-M.,Van Dorsselaer A.,Poch O.,Schaeffer C.,Lecompte O.
Ortho-proteogenomics: multiple proteomes investigation through orthology and a new MS-based protocol.
Genome Res.
19
128-135
2009
953301
Upadhyay A.,Fontes F.L.,Gonzalez-Juarrero M.,McNeil M.R.,Crans D.C.,Jackson M.,Crick D.C.
Partial saturation of menaquinone in Mycobacterium tuberculosis: function and essentiality of a novel reductase, MenJ.
ACS Cent. Sci.
1
292-302
2015