Any feedback?
Please rate this page
(sequences.php)
(0/150)

BRENDA support

Sequence of MENJ_MYCTO

EC Number:1.3.99.38

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
menaquinone-9 beta-reductase
P9WNY8
Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
408
43870
Reaction
menaquinone-9 + reduced acceptor = beta-dihydromenaquinone-9 + acceptor
Other sequences found for EC No. 1.3.99.38

General information:

Sequence
show sequence in normal format
>P9WNY8|menaquinone-9 beta-reductase|EC 1.3.99.38|Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)|Swiss-Prot
MSVDDSADVVVVGAGPAGSAAAAWAARAGRDVLVIDTATFPRDKPCGDGLTPRAVAELHQ
LGLGKWLADHIRHRGLRMSGFGGEVEVDWPGPSFPSYGSAVARLELDDRIRKVAEDTGAR
MLLGAKAVAVHHDSSRRVVSLTLADGTEVGCRQLIVADGARSPLGRKLGRRWHRETVYGV
AVRGYLSTAYSDDPWLTSHLELRSPDGAVLPGYGWIFPLGNGEVNIGVGALSTSRRPADL
ALRPLISYYTDLRRDEWGFTGQPRAVSSALLPMGGAVSGVAGSNWMLIGDAAACVNPLNG
EGIDYGLETGRLAAELLDSRDLARLWPSLLADRYGRGFSVARRLALLLTFPRFLPTTGPI
TMRSTALMNIAVRVMSNLVTDDDRDWVARVWRGGGQLSRLVDRRPPFS
Download this sequence
in fasta format
Download all sequences for 1.3.99.38
in fasta format
in csv (Excel, OpenOffice) format
Sequence related references
Sequence Reference
Authors
Title
Journal
Volume
Pages
Year
PubMed ID
953302
Fleischmann R.D.,Alland D.,Eisen J.A.,Carpenter L.,White O.,Peterson J.D.,DeBoy R.T.,Dodson R.J.,Gwinn M.L.,Haft D.H.,Hickey E.K.,Kolonay J.F.,Nelson W.C.,Umayam L.A.,Ermolaeva M.D.,Salzberg S.L.,Delcher A.,Utterback T.R.,Weidman J.F.,Khouri H.M.,Gill J.,Mikula A.,Bishai W.,Jacobs W.R. Jr.,Venter J.C.,Fraser C.M.
Whole-genome comparison of Mycobacterium tuberculosis clinical and laboratory strains.
J. Bacteriol.
184
5479-5490
2002