Any feedback?
Please rate this page
(sequences.php)
(0/150)

BRENDA support

Sequence of MENJ_MYCTU

EC Number:1.3.99.38

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
menaquinone-9 beta-reductase
P9WNY9
Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
408
43870
Reaction
menaquinone-9 + reduced acceptor = beta-dihydromenaquinone-9 + acceptor
Other sequences found for EC No. 1.3.99.38

General information:

Sequence
show sequence in normal format
>P9WNY9|menaquinone-9 beta-reductase|EC 1.3.99.38|Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)|Swiss-Prot
MSVDDSADVVVVGAGPAGSAAAAWAARAGRDVLVIDTATFPRDKPCGDGLTPRAVAELHQ
LGLGKWLADHIRHRGLRMSGFGGEVEVDWPGPSFPSYGSAVARLELDDRIRKVAEDTGAR
MLLGAKAVAVHHDSSRRVVSLTLADGTEVGCRQLIVADGARSPLGRKLGRRWHRETVYGV
AVRGYLSTAYSDDPWLTSHLELRSPDGAVLPGYGWIFPLGNGEVNIGVGALSTSRRPADL
ALRPLISYYTDLRRDEWGFTGQPRAVSSALLPMGGAVSGVAGSNWMLIGDAAACVNPLNG
EGIDYGLETGRLAAELLDSRDLARLWPSLLADRYGRGFSVARRLALLLTFPRFLPTTGPI
TMRSTALMNIAVRVMSNLVTDDDRDWVARVWRGGGQLSRLVDRRPPFS
Download this sequence
in fasta format
Download all sequences for 1.3.99.38
in fasta format
in csv (Excel, OpenOffice) format
Sequence related references
Sequence Reference
Authors
Title
Journal
Volume
Pages
Year
PubMed ID
953303
Cole S.T.,Brosch R.,Parkhill J.,Garnier T.,Churcher C.M.,Harris D.E.,Gordon S.V.,Eiglmeier K.,Gas S.,Barry C.E. III,Tekaia F.,Badcock K.,Basham D.,Brown D.,Chillingworth T.,Connor R.,Davies R.M.,Devlin K.,Feltwell T.,Gentles S.,Hamlin N.,Holroyd S.,Hornsby T.,Jagels K.,Krogh A.,McLean J.,Moule S.,Murphy L.D.,Oliver S.,Osborne J.,Quail M.A.,Rajandream M.A.,Rogers J.,Rutter S.,Seeger K.,Skelton S.,Squares S.,Squares R.,Sulston J.E.,Taylor K.,Whitehead S.,Barrell B.G.
Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.
Nature
393
537-544
1998
953304
Kelkar D.S.,Kumar D.,Kumar P.,Balakrishnan L.,Muthusamy B.,Yadav A.K.,Shrivastava P.,Marimuthu A.,Anand S.,Sundaram H.,Kingsbury R.,Harsha H.C.,Nair B.,Prasad T.S.,Chauhan D.S.,Katoch K.,Katoch V.M.,Kumar P.,Chaerkady R.,Ramachandran S.,Dash D.,Pandey A.
Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.
Mol. Cell. Proteomics
10
0-0
2011
953305
Schuessler D.L.,Parish T.
The promoter of Rv0560c is induced by salicylate and structurally-related compounds in Mycobacterium tuberculosis.
PLoS ONE
7
0-0
2012
953306
Upadhyay A.,Fontes F.L.,Gonzalez-Juarrero M.,McNeil M.R.,Crans D.C.,Jackson M.,Crick D.C.
Partial saturation of menaquinone in Mycobacterium tuberculosis: function and essentiality of a novel reductase, MenJ.
ACS Cent. Sci.
1
292-302
2015