Sequence of S4C3Z0_ENTFL

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
P-type Cu+ transporter
S4C3Z0
Enterococcus faecalis 02-MB-BW-10
828
87583
Reaction
ATP + H2O + Cu+[side 1] = ADP + phosphate + Cu+[side 2]
Sequences with same EC No.
Sequence
show sequence in normal format
>S4C3Z0|P-type Cu+ transporter|EC 7.2.2.8|Enterococcus faecalis 02-MB-BW-10|TrEMBL
MESKTFDIEGMSCASCAQTIEKATAKLPGMAKASVNLATEKLSVTYDQTEVTEEEIKEAV
SDAGYKAISPAQQRTFAIEGMSCASCAQTIEKAVNQLSGVQQAIVNLATEKLVVSYDDHQ
VTSAKIIKAVTDAGYQATEEVAAGATADQDREKKQKHIAEMWQRFWISAVFTVPLLYIAM
GHMVGLPLSDFLNPMTHATTFAMVQLILTLPVLYVGREFFTVGFKALFKGHPNMFSLVAL
GTSAAFVYSLYGTVMIFLGDTSFTMALYYESAGVILTLITLGKYFEAVSKGKTSDAIKKL
MGLAPKTAHILRDGAEIEVPVDAVQLDDIVIVRPGDKIPVDGVIVSGSSSVDEAMLTGES
LPVEKKVGDAVIGASINKNGSFQFKATKVGKETALAQIIQLVEDAQGSKAPIAQLADKIS
GVFVPIVIGLAVLSGLAWFFLGQESWIFALTITISVLVIACPCALGLATPTAIMVGTGKG
AENGVLIKSGDALETTHKIQTIVFDKTGTITEGKPVVTDILVADSALSEAELLTLAASAE
QGSEHPLGEAIVGAAKERQLPLVEGSDFSAIPGHGIRVTINERVLLLGNIKLMKEEAIEL
STFVQQADRLAEEGKTPMFVAKDGSFAGIIAVADTVKDSSQTAIARLHKMGIEAVMITGD
NKRTAEAIAKQVGIDRVLSEVLPEDKALEVKKLQAEGKKVAMVGDGINDAPALAQADVGI
AIGSGTDVAMESADIVLMRSDLMDVPTAVELSKATIKNIKENLFWAFAYNTLGIPVAMGV
LHLFGGPLLSPMIAAAAMSFSSVSVLLNALRLKGFKPSTVKRTSGSQK
Download this sequence
in fasta format
Download all sequences for 7.2.2.8
in fasta format
in csv (Excel, OpenOffice) format