Sequence of BENB_ACIAD

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
benzoate 1,2-dioxygenase
P07770
Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
169
20073
Reaction
benzoate + NADH + H+ + O2 = (1R,6S)-1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate + NAD+
Sequences with same EC No.
Sequence
show sequence in normal format
>P07770|benzoate 1,2-dioxygenase|EC 1.14.12.10|Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)|Swiss-Prot
MNATALLDTISIEQISQFLYSEARFLDDEQWDDWLECYAPQASFWMPAWDDNDQLTENPQ
TEISLIYYPDRQGLEDRVFRIKTERSSATMPDTRTAHNISNIEVESRDGLQITVRFNWNT
LSFRYKNSYSYFGMSRYVIDFSGEQPKILSKYVMLKNDYINQVIDIYHI
Download this sequence
in fasta format
Download all sequences for 1.14.12.10
in fasta format
in csv (Excel, OpenOffice) format
Sequence related references
Sequence Reference
Authors
Title
Journal
Volume
Pages
Year
PubMed ID
9818
Neidle E.L.,Hartnett C.,Ornston N.L.,Bairoch A.,Rekik M.,Harayama S.
Nucleotide sequences of the Acinetobacter calcoaceticus benABC genes for benzoate 1,2-dioxygenase reveal evolutionary relationships among multicomponent oxygenases.
J. Bacteriol.
173
5385-5395
1991
9819
Barbe V.,Vallenet D.,Fonknechten N.,Kreimeyer A.,Oztas S.,Labarre L.,Cruveiller S.,Robert C.,Duprat S.,Wincker P.,Ornston L.N.,Weissenbach J.,Marliere P.,Cohen G.N.,Medigue C.
Unique features revealed by the genome sequence of Acinetobacter sp. ADP1, a versatile and naturally transformation competent bacterium.
Nucleic Acids Res.
32
5766-5779
2004