Sequence of AT12A_CAVPO

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
H+/K+-exchanging ATPase
Q64392
Cavia porcellus
1033
114557
Reaction
ATP + H2O + H+[side 1] + K+[side 2] = ADP + phosphate + H+[side 2] + K+[side 1]
Sequences with same EC No.
Sequence
show sequence in normal format
>Q64392|H+/K+-exchanging ATPase|EC 7.2.2.19|Cavia porcellus|Swiss-Prot
MRRKTLEIYSVELDGTKDTKQLGQEEGKKCNELDLKKSSQKEELKKELDLDDHKLTSEEL
EQKYGTNIIRGLSSTRAAELLARDGPNALSPPKQTPEIIKFLKQMIGGFSILLWVGAILC
WIAYGIQYASNQSGSLDNVYLGVVLALVVILTGIFAYYQEAKSTNIMSSFSKMIPQEALV
TRDAEKKVIPAEQLVVGDIVEIKGGDQIPADIRLLFSQGCKVDNSSLTGESEPQPRSAEF
THENPLETKNIAFYSTTCLEGTATGMVINTGDRTIIGRIASLASGVGNEKTPIATEIEHF
VHIVAGVAVSIGILFFIIAVSLKYRVLDSIIFLIGIIVANVPEGLLATVTVTLSLTAKRM
AKKNCLVKNLEAVETLGSTSVICSDKTGTLTQNRMTVAHLWFDSQIFTADTSESQSNQAF
DQSSGTWASLSKIIALCNRAEFRPGQENVPIMKRVVVGDASETALLKFSEVILGDVMEIR
KRNRKVAEIPFNSTNKFQLSIHETEDPGDPRFLMVMKGAPERILEKCSTIMINGQEQPLD
KNNANAFHTAYMELGGMGERVLGFCHLYLPAHEFPENYSFDVDTMNFPTSNLCFVGLLSM
IDPPRSTVPDAVAKCRSAGIKVIMVTGDHPITAKAIAKSVGIISANSETVEDIAKRCNIA
VEQVNKQDARAAVVTGMELKDMTPEQLDEILANYPEIVFARTSPQQKLIIVEGCQRQNAV
VAVTGDGVNDSPALKKADIGIAMGIAGSDAAKNAADMVLLDDNFASIVTGVEEGRLIFDN
LKKTIAYTLTKNIAELCPFLVYIIVGLPLPIGTITILFIDLGTDIIPSIALAYEKVESDI
MNRKPRHKKKDRLVNHQLAIYSYLHIGLMQALGAFLVYFTVYAQQGFWPTSLIQLRVKWE
QDYVNDLEDSYGQQWTRYQRKYLEWTGYTAFFVGIMVQQIADLIIRKTRRNSIFQQGLFR
NKVIWVGITSQIIVALILSCGLGSITALNFTMLRVQYWFVAVPHAILIWVYDEVRKLFLR
LYPGSWWDKNMYY
Download this sequence
in fasta format
Download all sequences for 7.2.2.19
in fasta format
in csv (Excel, OpenOffice) format
Sequence related references
Sequence Reference
Authors
Title
Journal
Volume
Pages
Year
PubMed ID
7586
Pestov N.B.,Romanova L.G.,Korneenko T.V.,Egorov M.V.,Kostina M.B.,Sverdlov V.E.,Askari A.,Shakhparonov M.I.,Modyanov N.N.
Ouabain-sensitive H,K-ATPase: tissue-specific expression of the mammalian genes encoding the catalytic alpha subunit.
FEBS Lett.
440
320-324
1998