Sequence of TAUB_BURMA

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
ABC-type taurine transporter
Q62AW4
Burkholderia mallei (strain ATCC 23344)
260
28094
Reaction
ATP + H2O + taurine-[taurine-binding protein][side 1] = ADP + phosphate + taurine[side 2] + [taurine-binding protein][side 1]
Sequences with same EC No.
Sequence
show sequence in normal format
>Q62AW4|ABC-type taurine transporter|EC 7.6.2.7|Burkholderia mallei (strain ATCC 23344)|Swiss-Prot
MAKLCAQQVSVVYASRRGALTALENVSMSVGSGEIVVALGASGCGKSTLLSLLAGFQPPT
SGRVSVDGAPVAGPGADRGVVFQDDALMPWLNVIENVAFGLRMQGVGRDARHARARDVLR
LVKLAGFEQHRIDEISGGMRQRVGLARALAADPSFLLMDEPLGALDALTREHMQTLLLDV
WRATGKGVFLITHSVEEAVLLATELLILSPRPGRIVARHSLDFARRYAHGEPMRSIKSDP
RFTEIHLALVEQLMRETEEV
Download this sequence
in fasta format
Download all sequences for 7.6.2.7
in fasta format
in csv (Excel, OpenOffice) format
Sequence related references
Sequence Reference
Authors
Title
Journal
Volume
Pages
Year
PubMed ID
1094598
Nierman W.C.,DeShazer D.,Kim H.S.,Tettelin H.,Nelson K.E.,Feldblyum T.V.,Ulrich R.L.,Ronning C.M.,Brinkac L.M.,Daugherty S.C.,Davidsen T.D.,DeBoy R.T.,Dimitrov G.,Dodson R.J.,Durkin A.S.,Gwinn M.L.,Haft D.H.,Khouri H.M.,Kolonay J.F.,Madupu R.,Mohammoud Y.,Nelson W.C.,Radune D.,Romero C.M.,Sarria S.,Selengut J.,Shamblin C.,Sullivan S.A.,White O.,Yu Y.,Zafar N.,Zhou L.,Fraser C.M.
Structural flexibility in the Burkholderia mallei genome.
Proc. Natl. Acad. Sci. U.S.A.
101
14246-14251
2004