Sequence of I4F244_9ACTN

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
long-chain-acyl-CoA dehydrogenase
I4F244
Modestobacter marinus
381
41921
Reaction
Sequences with same EC No.
Sequence
show sequence in normal format
>I4F244|long-chain-acyl-CoA dehydrogenase|EC 1.3.99.13|Modestobacter marinus|TrEMBL
MRHRLYEADHEDFRKSVRAFLDEHVAPFHDDWERAGIVPRELWTAAGAQGLLGIGMEERF
GGGGVRDFRWSCVLVEELARIGASGVGFGLHDDVVGPYLRDLATEEQKQRWLPGFCSGEL
ITAIAMTEPAAGSDLQGIRTTARRDGDGWVLNGSKTFITNGINADLVIVVARTATDVPAS
RGLSLLVVERGMPGFSRGRNLDKVGLKAQDTAELFFDDVRVPDANLLGTRDQGFAHLMHN
LPQERLHIAVSAVAAAETVLALTVGYVTERTAFGRPVGSFQHSRFVLAELQTEVAIARTF
VDECVRQLDSGDLTATDAAMAKWWTTELQNKVADRCLQLHGGYGYMSEYRVSKAWRDARV
QSIYGGTNEIMKEIIGRSMGL
Download this sequence
in fasta format
Download all sequences for 1.3.99.13
in fasta format
in csv (Excel, OpenOffice) format
Sequence related references
Sequence Reference
Authors
Title
Journal
Volume
Pages
Year
PubMed ID
20741904
Normand P.,Gury J.,Pujic P.,Chouaia B.,Crotti E.,Brusetti L.,Daffonchio D.,Vacherie B.,Barbe V.,Medigue C.,Calteau A.,Ghodhbane-Gtari F.,Essoussi I.,Nouioui I.,Abbassi-Ghozzi I.,Gtari M.
Genome sequence of radiation-resistant Modestobacter marinus strain BC501, a representative Actinobacterium that thrives on calcareous stone surfaces.
J. Bacteriol.
194
4773-4774
2012