Sequence of Q24R56_DESHY

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
urocanate reductase
Q24R56
Desulfitobacterium hafniense (strain Y51)
660
69952
Reaction
dihydrourocanate + acceptor = urocanate + reduced acceptor
Sequences with same EC No.
Sequence
show sequence in normal format
>Q24R56|urocanate reductase|EC 1.3.99.33|Desulfitobacterium hafniense (strain Y51)|TrEMBL
MTFDANAITDVKIEGADETPAVGGKAIEEFPGMLMEAQSADIDGISGASYTSKAVLAAAA
NCVAQAKGEDTDQKTPVADGTYSGQAPGFSWTGMIKADVTFKDNAITDINIVEEQETYTG
EIFYTVLDNYIPRILEAQSLAVDGISGATLSSNGVRGCVEQAIEAAGGRSSEWYGEVAKS
TKTVKKEGYDVIIVGMGGSGITSFLSAAQAGAKVFGIETTAKLGGQSATTSGPMAANSQV
KMDEEFGGKEYIDADALYKAWNDYCGADAKPEMIRMTIDESGETLDWMIKDWGFQFSPMS
SFILSPYPDWKIWCYYGGETKNRFGTNKTYMFENAVKKAQDQNPAAEYMLELTAQELLMD
GDKVAGVKAVYYDGTIYEIYGKTVILATGGFIGNADMMNEYLDGPANTVAMTVDDGDGIK
LGLSAGGALMNPDIPPMVHINQVANLIKNNDLDADGKQVLTSLAIATDALAVDGNGKLWN
TREEICLAPQYRYYNIYTAAQIEAIKTKGLAKVNKSMFMDQGGTVEAGKPIANIDEILKV
GAGYKNVLTAESAEDLAKAIDCDAATLKDSLNGAQGPYYAVICSGYAYATCGGLNVDDAM
NVLRADGSPIGNLYAVGQDSMGVLFSSDVPYTPYGGQAQSWALTSGRLAGANAAKYAMGK
Download this sequence
in fasta format
Download all sequences for 1.3.99.33
in fasta format
in csv (Excel, OpenOffice) format
Sequence related references
Sequence Reference
Authors
Title
Journal
Volume
Pages
Year
PubMed ID
163318038
Nonaka H.,Keresztes G.,Shinoda Y.,Ikenaga Y.,Abe M.,Naito K.,Inatomi K.,Furukawa K.,Inui M.,Yukawa H.
Complete genome sequence of the dehalorespiring bacterium Desulfitobacterium hafniense Y51 and comparison with Dehalococcoides ethenogenes 195.
J. Bacteriol.
188
2262-2274
2006