Any feedback?
Please rate this page
(sequences.php)
(0/150)

BRENDA support

Sequence of C80B1_ESCCA

EC Number:1.14.14.102

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
N-methylcoclaurine 3'-monooxygenase
O64899
Eschscholzia californica
487
54644
Reaction
(S)-N-methylcoclaurine + [reduced NADPH-hemoprotein reductase] + O2 = (S)-3'-hydroxy-N-methylcoclaurine + [oxidized NADPH-hemoprotein reductase] + H2O
Other sequences found for EC No. 1.14.14.102

General information:

Sequence
show sequence in normal format
>O64899|N-methylcoclaurine 3'-monooxygenase|EC 1.14.14.102|Eschscholzia californica|Swiss-Prot
GTSTVALIAVIISSILYLLFGGSGHKNLPPGPKPWPIVGNLLQLGEKPHAQFAELAQTYG
DIFTLKMGTETVVVASTSSAASEILKTHDRILSARYVFQSFRVKGHVENSIVWSDCTETW
KNLRKVCRTELFTQKMIESQAHVREKKCEEMVEYLMKKQGEEVKIVEVIFGTLVNIFGNL
IFSQNIFELGDPNSGSSEFKEYLWRMLELGNSTNPADYFPMLGKFDLFGQRKEVAECLKG
IYAIWGAMLQERKLAKKVDGYKSKNDFVDVCLDSGLNDYQINALLMELFGAGTETSASTI
EWAMTELTKNPKITAKIRSEIQTVVGERSVKESDFPNLPYLEATVKETLRLHPPTPLLLP
RRALETCTILNYTIPKDCQIMVNAWGIGRDPKTWTDPLTFSPERFLNSSVDFRGNDFSLI
PFGAGRRICPGLPIANQFIALLVATFVQNLDWCLPNGMSVDHLIVEEKFGLTLQKEPPLF
IVPKSRV
Download this sequence
in fasta format
Download all sequences for 1.14.14.102
in fasta format
in csv (Excel, OpenOffice) format
Sequence related references
Sequence Reference
Authors
Title
Journal
Volume
Pages
Year
PubMed ID
1164400
Pauli H.H.,Kutchan T.M.
Molecular cloning and functional heterologous expression of two alleles encoding (S)-N-methylcoclaurine 3'-hydroxylase (CYP80B1), a new methyl jasmonate-inducible cytochrome P-450-dependent mono-oxygenase of benzylisoquinoline alkaloid biosynthesis.
Plant J.
13
793-801
1998