Any feedback?
Please rate this page
(sequences.php)
(0/150)

BRENDA support

Sequence of CCCR_CERS4

EC Number:1.3.1.85

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
crotonyl-CoA carboxylase/reductase
Q3IZ91
Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
430
47684
Reaction
(2S)-ethylmalonyl-CoA + NADP+ = (E)-but-2-enoyl-CoA + CO2 + NADPH + H+
Other sequences found for EC No. 1.3.1.85

General information:

Sequence
show sequence in normal format
>Q3IZ91|crotonyl-CoA carboxylase/reductase|EC 1.3.1.85|Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)|Swiss-Prot
MALDVQSDIVAYDAPKKDLYEIGEMPPLGHVPKEMYAWAIRRERHGEPDQAMQIEVVETP
SIDSHEVLVLVMAAGVNYNGIWAGLGVPVSPFDGHKQPYHIAGSDASGIVWAVGDKVKRW
KVGDEVVIHCNQDDGDDEECNGGDPMFSPTQRIWGYETPDGSFAQFTRVQAQQLMKRPKH
LTWEEAACYTLTLATAYRMLFGHKPHDLKPGQNVLVWGASGGLGSYAIQLINTAGANAIG
VISEEDKRDFVMGLGAKGVINRKDFKCWGQLPKVNSPEYNEWLKEARKFGKAIWDITGKG
INVDMVFEHPGEATFPVSSLVVKKGGMVVICAGTTGFNCTFDVRYMWMHQKRLQGSHFAN
LKQASAANQLMIERRLDPCMSEVFPWAEIPAAHTKMYRNQHKPGNMAVLVQAPRTGLRTF
ADVLEAGRKA
Download this sequence
in fasta format
Download all sequences for 1.3.1.85
in fasta format
in csv (Excel, OpenOffice) format
Sequence related references
Sequence Reference
Authors
Title
Journal
Volume
Pages
Year
PubMed ID
1166186
Erb T.J.,Berg I.A.,Brecht V.,Muller M.,Fuchs G.,Alber B.E.
Synthesis of C5-dicarboxylic acids from C2-units involving crotonyl-CoA carboxylase/reductase: the ethylmalonyl-CoA pathway.
Proc. Natl. Acad. Sci. U.S.A.
104
10631-10636
2007
1166188
Erb T.J.,Retey J.,Fuchs G.,Alber B.E.
Ethylmalonyl-CoA mutase from Rhodobacter sphaeroides defines a new subclade of coenzyme B12-dependent acyl-CoA mutases.
J. Biol. Chem.
283
32283-32293
2008
1166189
Erb T.J.,Brecht V.,Fuchs G.,Mueller M.,Alber B.E.
Carboxylation mechanism and stereochemistry of crotonyl-CoA carboxylase/reductase, a carboxylating enoyl-thioester reductase.
Proc. Natl. Acad. Sci. U.S.A.
106
8871-8876
2009
1166190
Schneider K.,Asao M.,Carter M.S.,Alber B.E.
Rhodobacter sphaeroides uses a reductive route via propionyl coenzyme A to assimilate 3-hydroxypropionate.
J. Bacteriol.
194
225-232
2012