Sequence of MENH_SHIDS

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase
Q32DS5
Shigella dysenteriae serotype 1 (strain Sd197)
252
27755
Reaction
5-enolpyruvoyl-6-hydroxy-2-succinylcyclohex-3-ene-1-carboxylate = (1R,6R)-6-hydroxy-2-succinylcyclohexa-2,4-diene-1-carboxylate + pyruvate
Sequences with same EC No.
Sequence
show sequence in normal format
>Q32DS5|2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase|EC 4.2.99.20|Shigella dysenteriae serotype 1 (strain Sd197)|Swiss-Prot
MILHAQTKHGKPGLPWLVFLHGFSGDCHEWQEVGEVFADYSRLYVDLPGHGGSAAISVDG
FDDVTDLLRKTLVSYNILDFWLVGYSLGGRVAMMAACQGLAGLCGVIVEGGHPGLQNAEQ
RAERQRSDRQWAQRFRTEPLTAVFADWYQQPVFASLNDDQRRELVALRSNNNGATLAAML
EATSLAVQPDLRANLSARTFAFYYLCGERDSKFRALAAELAADCHVIPRAGHNAHRENPA
GVIASLAQILRF
Download this sequence
in fasta format
Download all sequences for 4.2.99.20
in fasta format
in csv (Excel, OpenOffice) format
Sequence related references
Sequence Reference
Authors
Title
Journal
Volume
Pages
Year
PubMed ID
1173676
Yang F.,Yang J.,Zhang X.,Chen L.,Jiang Y.,Yan Y.,Tang X.,Wang J.,Xiong Z.,Dong J.,Xue Y.,Zhu Y.,Xu X.,Sun L.,Chen S.,Nie H.,Peng J.,Xu J.,Wang Y.,Yuan Z.,Wen Y.,Yao Z.,Shen Y.,Qiang B.,Hou Y.,Yu J.,Jin Q.
Genome dynamics and diversity of Shigella species, the etiologic agents of bacillary dysentery.
Nucleic Acids Res.
33
6445-6458
2005