Sequence of MENH_SHIF8

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase
Q0T2M0
Shigella flexneri serotype 5b (strain 8401)
252
27729
Reaction
5-enolpyruvoyl-6-hydroxy-2-succinylcyclohex-3-ene-1-carboxylate = (1R,6R)-6-hydroxy-2-succinylcyclohexa-2,4-diene-1-carboxylate + pyruvate
Sequences with same EC No.
Sequence
show sequence in normal format
>Q0T2M0|2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase|EC 4.2.99.20|Shigella flexneri serotype 5b (strain 8401)|Swiss-Prot
MILHAQAKHGKLGLPWLVFLHGFSGDCHEWQEVGEAFADYSRLYVDLLGHGGSAAISVDG
FDDVTDLLRKTLVSYNILDFWLVGYSLGGRVAMMAACQGLAGLCGVIVEGGHPGLQNAEQ
RAERQRSDRQWAQRFRTEPLTAVFADWYQQPVFASLNDDQRRELVALRSNNNGATLAAML
EATSLAVQPDLRANLSARTFAFYYLCGERDSKFRALAAELAADCHVIPRAGHNAHRENPA
GVIASLAQILRF
Download this sequence
in fasta format
Download all sequences for 4.2.99.20
in fasta format
in csv (Excel, OpenOffice) format
Sequence related references
Sequence Reference
Authors
Title
Journal
Volume
Pages
Year
PubMed ID
1173677
Nie H.,Yang F.,Zhang X.,Yang J.,Chen L.,Wang J.,Xiong Z.,Peng J.,Sun L.,Dong J.,Xue Y.,Xu X.,Chen S.,Yao Z.,Shen Y.,Jin Q.
Complete genome sequence of Shigella flexneri 5b and comparison with Shigella flexneri 2a.
BMC Genomics
7
173-173
2006