Sequence of MENH_SHIFL

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase
Q83QT4
Shigella flexneri
252
27729
Reaction
5-enolpyruvoyl-6-hydroxy-2-succinylcyclohex-3-ene-1-carboxylate = (1R,6R)-6-hydroxy-2-succinylcyclohexa-2,4-diene-1-carboxylate + pyruvate
Sequences with same EC No.
Sequence
show sequence in normal format
>Q83QT4|2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase|EC 4.2.99.20|Shigella flexneri|Swiss-Prot
MILHAQAKHGKLGLPWLVFLHGFSGDCHEWQEVGEAFADYSRLYVDLLGHGGSAAISVDG
FDDVTDLLRKTLVSYNILDFWLVGYSLGGRVAMMAACQGLAGLCGVIVEGGHPGLQNAEQ
RAERQRSDRQWAQRFRTEPLTAVFADWYQQPVFASLNDDQRRELVALRSNNNGATLAAML
EATSLAVQPDLRANLSARTFAFYYLCGERDSKFRALAAELAADCHVIPRAGHNAHRENPA
GVIASLAQILRF
Download this sequence
in fasta format
Download all sequences for 4.2.99.20
in fasta format
in csv (Excel, OpenOffice) format
Sequence related references
Sequence Reference
Authors
Title
Journal
Volume
Pages
Year
PubMed ID
1173678
Jin Q.,Yuan Z.,Xu J.,Wang Y.,Shen Y.,Lu W.,Wang J.,Liu H.,Yang J.,Yang F.,Zhang X.,Zhang J.,Yang G.,Wu H.,Qu D.,Dong J.,Sun L.,Xue Y.,Zhao A.,Gao Y.,Zhu J.,Kan B.,Ding K.,Chen S.,Cheng H.,Yao Z.,He B.,Chen R.,Ma D.,Qiang B.,Wen Y.,Hou Y.,Yu J.
Genome sequence of Shigella flexneri 2a: insights into pathogenicity through comparison with genomes of Escherichia coli K12 and O157.
Nucleic Acids Res.
30
4432-4441
2002
1173679
Wei J.,Goldberg M.B.,Burland V.,Venkatesan M.M.,Deng W.,Fournier G.,Mayhew G.F.,Plunkett G. III,Rose D.J.,Darling A.,Mau B.,Perna N.T.,Payne S.M.,Runyen-Janecky L.J.,Zhou S.,Schwartz D.C.,Blattner F.R.
Complete genome sequence and comparative genomics of Shigella flexneri serotype 2a strain 2457T.
Infect. Immun.
71
2775-2786
2003