Sequence of A0A1A7NWL8_9PAST

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
tRNA pseudouridine32 synthase
A0A1A7NWL8
Gallibacterium anatis
217
24717
Reaction
tRNA uridine32 = tRNA pseudouridine32
Sequences with same EC No.
Sequence
show sequence in normal format
>A0A1A7NWL8|tRNA pseudouridine32 synthase|EC 5.4.99.28|Gallibacterium anatis|TrEMBL
MALIAYNPPQGLNILYQDNYIAVVNKQSGLLSVPGNQPQYQDSATTRVANKFGFTEPAHR
LDMATSGILLFALSKAAEKELKRQFREREPKKHYQAIVWGHLEQDSGIVDLPLICDWENR
PRQRIDFLVGKKAQTQYQVLARYPNNTTRVKLTPITGRSHQLRLHMLALGHPILGDKFYS
PPAVRAMAPRLYLHAESLTITHPITQERMTFTCPPDF
Download this sequence
in fasta format
Download all sequences for 5.4.99.28
in fasta format
in csv (Excel, OpenOffice) format