Sequence of A0A3R2T5V6_9ZZZZ

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
anthranilate 1,2-dioxygenase (deaminating, decarboxylating)
A0A3R2T5V6
compost metagenome
163
18826
Reaction
anthranilate + NAD(P)H + 2 H+ + O2 = catechol + CO2 + NAD(P)+ + NH3
Sequences with same EC No.
Sequence
show sequence in normal format
>A0A3R2T5V6|anthranilate 1,2-dioxygenase (deaminating, decarboxylating)|EC 1.14.12.1|compost metagenome|TrEMBL
MSQLNDLSPAALRAELRDLYEDYAVCLDEGDLEAWPGFFTEDCHYRVLSRENHDAGLPLG
LIYCMNKNMLKDRVTALRETTMFEPRSLRHFISGVTVRERQGDQVVAQANFAIMESLSDR
EPSLNMVGRYLDTWRQTDAGWRLASRDCVYDNYRVRTSLIVPI
Download this sequence
in fasta format
Download all sequences for 1.14.12.1
in fasta format
in csv (Excel, OpenOffice) format