Any feedback?
Please rate this page
(sequences.php)
(0/150)

BRENDA support

Sequence of A0A375EBJ1_9BURK

EC Number:1.11.1.10

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
chloride peroxidase
A0A375EBJ1
Cupriavidus taiwanensis
276
30449
Reaction
RH + chloride + H2O2 = RCl + 2 H2O
Other sequences found for EC No. 1.11.1.10

General information:

Sequence
show sequence in normal format
>A0A375EBJ1|chloride peroxidase|EC 1.11.1.10|Cupriavidus taiwanensis|TrEMBL
MGYVTTKDGVDIFYKDWGPRDAQVIFFHHGWPLSADDWDAQMLFFLAQGFRVVAHDRRGH
GRSSQVWDGHDMDHYADDVAAVVSHLGVEKAVHVGHSTGGGEVIHYVARHGEDHVAKAVL
ISAVPPLMVKTESNPGGLPKDVFDDFQAKLAANRAQFYYDIAAGPFYGYNRPDAKPSQGV
IWNWWRQGMMGSAKAHYDGIVAFSQTDFTEDLKRATIPVLVMHGDDDQVVPYADSAPLSA
KLLKHGTLKTYPGFPHGMPTSNADTINADLLAFVRS
Download this sequence
in fasta format
Download all sequences for 1.11.1.10
in fasta format
in csv (Excel, OpenOffice) format