Sequence of A0A0H4LDX6_9LACO

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
hydroxymethylglutaryl-CoA reductase
A0A0H4LDX6
Lactobacillus farciminis
417
45541
Reaction
(R)-mevalonate + CoA + 2 NAD+ = 3-hydroxy-3-methylglutaryl-CoA + 2 NADH + 2 H+
Sequences with same EC No.
Sequence
show sequence in normal format
>A0A0H4LDX6|hydroxymethylglutaryl-CoA reductase|EC 1.1.1.88|Lactobacillus farciminis|TrEMBL
MSNLMKIYELTLEQRIKYLLENEYINQRQADSLLKRQTISKDLADSLSENQIGSFSLPYG
FATDFLVNGKDYIVPMTIEEPSVVAAASNGAKRIKNSGGFKAFPSKRIVYGQIVLEKITD
VDFEQLEQNNSEIFSFAQNAHPSLLKRGGGVVSLKFNRYDEFTEIELGIDTVDAMGANMV
NTILEKTAHKIVELTNDDVLCSILSNSGQGQVITVEARVDFAQLGTKNMAGEQVANRIVQ
LSNFAQKSIKRAITHNKGIMNGIDAVLLATGNDFRAQEAAAHSFAFESGQYQPFSEWHIE
DNQLVGTLKMPIELGSVGGAIRALPMAQLSLAIMKIENSQELQSVVGAVGLANNLSAIRA
LVTTGIQAGHMGLQSKSLAVSAGAIGSEIHLVAEKLNQTKDYTIKNAENILKELREK
Download this sequence
in fasta format
Download all sequences for 1.1.1.88
in fasta format
in csv (Excel, OpenOffice) format
Sequence related references
Sequence Reference
Authors
Title
Journal
Volume
Pages
Year
PubMed ID
1430778
Tareb R.,Bernardeau M.,Vernoux J.P.
Genome Sequence of Rough and Smooth Variants of Pleomorphic Strain Lactobacillus farciminis CNCM-I-3699.
Genome Announc.
3
0-15
2015