Sequence of A0A404B2T0_9ZZZZ

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
albonoursin synthase
A0A404B2T0
compost metagenome
343
38805
Reaction
cyclo(L-leucyl-L-phenylalanyl) + 2 O2 = albonoursin + 2 H2O2
Sequences with same EC No.
Sequence
show sequence in normal format
>A0A404B2T0|albonoursin synthase|EC 1.3.3.13|compost metagenome|TrEMBL
MSISPLNTVKKALRRFAPSVIPYTKRIIKISYYLRDIKTSWKYMNWPATTADYGKLSSEL
IFQYHKLEKGLCMPGPKRFFGEQPAIATITLINRWNENGFKTANPIYFGAIETLRAYGDF
IANTPLPSTSDQSLKEKIETILAANLESPNQFKTPIPISKPNNLLWEEFSTLMVMRRSVR
NYLPKKVKTETIEECINIANLSPSVCNRQTCKVRIYEDPDQITKLLTFQNGNRGFGHLLS
TLLIITSDTRYFFDGSERNQPFIDGGLLSMSLILALQSKGISSCCLNWCVSPTADNQAHI
VGGIPDHERIIMYLAIGYPAEGAVVPKSERRAQNEIAIQYTNM
Download this sequence
in fasta format
Download all sequences for 1.3.3.13
in fasta format
in csv (Excel, OpenOffice) format