Sequence of A0A045IRA9_MYCTX

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
NAD(P)+ transhydrogenase (Re/Si-specific)
A0A045IRA9
Mycobacterium tuberculosis
366
37694
Reaction
NADPH + NAD+ = NADP+ + NADH
Sequences with same EC No.
Sequence
show sequence in normal format
>A0A045IRA9|NAD(P)+ transhydrogenase (Re/Si-specific)|EC 1.6.1.2|Mycobacterium tuberculosis|TrEMBL
MTDPQTQSTRVGVVAESGPDERRVALVPKAVASLVNRGVAVVVEAGAGERALLPDELYTA
VGASIGDAWAADVVVKVAPPTAAEVGRLRGGQTLIGFLAPRNADNSIGALTQAGVQAFAL
EAIPRISRAQVMDALSSQANVSGYKAVLLAASESTRFFPMLTTAAGTVKPATVLVLGVGV
AGLQALATAKRLGARTTGYDVRPEVADQVRSVGAQWLDLGISASGEGGYARELTDDERAQ
QQKALEEAISGFDVVITTALVPGRPAPTLVTAAAVEAMKPGSVVVDLAGETGGNCELTEP
GRTVVKHDVTIAAPLNLPATMPEHASELYSKNITALLDLLIKDGRLAPDFDDEVIAQSCV
TRGKDS
Download this sequence
in fasta format
Download all sequences for 1.6.1.2
in fasta format
in csv (Excel, OpenOffice) format
Sequence related references
Sequence Reference
Authors
Title
Journal
Volume
Pages
Year
PubMed ID
1581400
Shah N.S.,Auld S.C.,Brust J.C.,Mathema B.,Ismail N.,Moodley P.,Mlisana K.,Allana S.,Campbell A.,Mthiyane T.,Morris N.,Mpangase P.,van der Meulen H.,Omar S.V.,Brown T.S.,Narechania A.,Shaskina E.,Kapwata T.,Kreiswirth B.,Gandhi N.R.
Transmission of Extensively Drug-Resistant Tuberculosis in South Africa.
N. Engl. J. Med.
376
243-253
2017