Sequence of A0A3G7PVT1_9PSED

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
NAD(P)+ transhydrogenase (Re/Si-specific)
A0A3G7PVT1
Pseudomonas chlororaphis subsp. aureofaciens
107
11409
Reaction
NADPH + NAD+ = NADP+ + NADH
Sequences with same EC No.
Sequence
show sequence in normal format
>A0A3G7PVT1|NAD(P)+ transhydrogenase (Re/Si-specific)|EC 1.6.1.2|Pseudomonas chlororaphis subsp. aureofaciens|TrEMBL
MEELISPGIYNLIIFVLAIYVGYHVVWNVTPALHTPLMAVTNAISAIVIVGAMLAAALTV
TPLGKTMGTLAVALAAVNVFGGFLVTRRMLEMFKKKAPKAVKEEAPK
Download this sequence
in fasta format
Download all sequences for 1.6.1.2
in fasta format
in csv (Excel, OpenOffice) format