Sequence of A0A4Q8ILP0_ECOLX

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
ribonuclease E
A0A4Q8ILP0
Escherichia coli
1061
118294
Reaction
endonucleolytic cleavage of single-stranded RNA in A- and U-rich regions
Sequences with same EC No.
Sequence
show sequence in normal format
>A0A4Q8ILP0|ribonuclease E|EC 3.1.26.12|Escherichia coli|TrEMBL
MKRMLINATQQEELRVALVDGQRLYDLDIESPGHEQKKANIYKGKITRIEPSLEAAFVDY
GAERHGFLPLKEIAREYFPANYSAHGRPNIKDVLREGQEVIVQIDKEERGNKGAALTTFI
SLAGSYLVLMPNNPRAGGISRRIEGDDRTELKEALASLELPEGMGLIVRTAGVGKSAEAL
QWDLSFRLKHWEAIKKAAESRPAPFLIHQESNVIVRAFRDYLRQDIGEILIDNPKVLELA
RQHIAALGRPDFSSKIKLYTGEIPLFSHYQIESQIESAFQREVRLPSGGSIVIDSTEALT
AIDINSARATRGGDIEETAFNTNLEAADEIARQLRLRDLGGLIVIDFIDMTPVRHQRAVE
NRLREAVRQDRARIQISHISRFGLLEMSRQRLSPSLGESSHHVCPRCSGTGTVRDNESLS
LSILRLIEEEALKENTQEVHAIVPVPIASYLLNEKRSAVNAIETRQDGVRCVIVPNDQME
TPHYHVLRVRKGEETPTLSYMLPKLHEEAMALPSEEEFAERKRPEQPALATFAMPDVPPA
PTPAEPAAPVVAPAPKAAPATPATPAQPGLLSRFFGALKALFSGSEETKPTEQPAPKAEA
KPERQQDRRKPRQNNRRDRNERRDTRSERTEGSDNREENRRNRRQAQQQTAETRESRQQA
EVTEKARTTDEQQAPRRERSRRRNDDKRQAQQEAKALNVEEQSVQETEQEERVRPVQPRR
KQRQLNQKVRYEQSVAEEAVVAPVVEETAAAEPIVQEAPAPRTELVKVPLPVVAQTAPEQ
QEENNADNRDNGGMPRRSRRSPRHLRVSGQRRRRYRDERYPTQSPMPLTVACASPELASG
KVWIRYPIVRPQDVQVEEQREQEEVQVQPMVTEVPVAAAVEPVVSAPVVEEMAEVVEAPV
PVAEPQPEVVETTHPEVIAAAVTEQPQVITESDVAVAQEVAEHAEPVVEPQEETADIEEV
AETAEVVVAEPEVVAQPAASVVAEVAAEVETVAAVEPEITVEHNHATAPMTRAPAPEYVP
EAPRHSDWQRPTFAFEGKGAAGGHTATHHASAAPARPQPVE
Download this sequence
in fasta format
Download all sequences for 3.1.26.12
in fasta format
in csv (Excel, OpenOffice) format