Sequence of B5H3R7_STRC2

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
succinate dehydrogenase
B5H3R7
Streptomyces clavuligerus (strain ATCC 27064 / DSM 738 / JCM 4710 / NBRC 13307 / NCIMB 12785 / NRRL 3585 / VKM Ac-602)
158
17489
Reaction
Sequences with same EC No.
Sequence
show sequence in normal format
>B5H3R7|succinate dehydrogenase|EC 1.3.99.1|Streptomyces clavuligerus (strain ATCC 27064 / DSM 738 / JCM 4710 / NBRC 13307 / NCIMB 12785 / NRRL 3585 / VKM Ac-602)|TrEMBL
MSADTSSAIGSVESAPVYDVDNPAPVIEAPRKRTGRTPRSTRGNFEMAAWLFMRLSGVVL
VVLVIGHLIIQLVLDGGVSKIGFAFVAGRWASPFWQVWDLLMLWLAMLHGANGLRTVIND
YAERPNTRLWLKGLLYTATVFTILLGTLVIFTFDPNIR
Download this sequence
in fasta format
Download all sequences for 1.3.99.1
in fasta format
in csv (Excel, OpenOffice) format
Sequence related references
Sequence Reference
Authors
Title
Journal
Volume
Pages
Year
PubMed ID
1728071
Medema M.H.,Trefzer A.,Kovalchuk A.,van den Berg M.,Mueller U.,Heijne W.,Wu L.,Alam M.T.,Ronning C.M.,Nierman W.C.,Bovenberg R.A.L.,Breitling R.,Takano E.
The sequence of a 1.8-mb bacterial linear plasmid reveals a rich evolutionary reservoir of secondary metabolic pathways.
Genome Biol. Evol.
2
212-224
2010