Any feedback?
Please rate this page
(sequences.php)
(0/150)

BRENDA support

Sequence of E6YZB4_BARSR

EC Number:1.11.1.10

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
chloride peroxidase
E6YZB4
Bartonella schoenbuchensis (strain DSM 13525 / NCTC 13165 / R1)
257
28109
Reaction
RH + chloride + H2O2 = RCl + 2 H2O
Other sequences found for EC No. 1.11.1.10

General information:

Sequence
show sequence in normal format
>E6YZB4|chloride peroxidase|EC 1.11.1.10|Bartonella schoenbuchensis (strain DSM 13525 / NCTC 13165 / R1)|TrEMBL
MTAKDVYFFEHDGLRFAYREEGQGIPILLIHGFGSSARINWYATGWFRSLVEAGYRVIAL
DNRGHGDSVKSYDPLFYTPQAMAGDAVKLLQHLGLSKVHVMGYSMGARISAFMALLYPTY
VHSVIFGGLGIGMVTGGGDWKPVSEALLAEDVSTITNARGLMFRKFVDQTKSDRRALATC
IMTSAQKLTESDVHKIKQPALVAVGSLDDISGEAEPLVALLPHGEVLEIPGRDHMLAVGD
QVYKKGVIDFLSRYPIA
Download this sequence
in fasta format
Download all sequences for 1.11.1.10
in fasta format
in csv (Excel, OpenOffice) format
Sequence related references
Sequence Reference
Authors
Title
Journal
Volume
Pages
Year
PubMed ID
1638811
Engel P.,Salzburger W.,Liesch M.,Chang C.C.,Maruyama S.,Lanz C.,Calteau A.,Lajus A.,Medigue C.,Schuster S.C.,Dehio C.
Parallel evolution of a type IV secretion system in radiating lineages of the host-restricted bacterial pathogen Bartonella.
PLoS Genet.
7
0-0
2011
1638812
Harms A.,Segers F.H.,Quebatte M.,Mistl C.,Manfredi P.,Korner J.,Chomel B.B.,Kosoy M.,Maruyama S.,Engel P.,Dehio C.
Evolutionary Dynamics of Pathoadaptation Revealed by Three Independent Acquisitions of the VirB/D4 Type IV Secretion System in Bartonella.
Genome Biol. Evol.
9
761-776
2017