Sequence of A0A076NIP6_9CORY

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
2-halobenzoate 1,2-dioxygenase
A0A076NIP6
Corynebacterium imitans
491
55275
Reaction
a 2-halobenzoate + NADH + H+ + O2 = catechol + a halide anion + NAD+ + CO2
Sequences with same EC No.
Sequence
show sequence in normal format
>A0A076NIP6|2-halobenzoate 1,2-dioxygenase|EC 1.14.12.13|Corynebacterium imitans|TrEMBL
MTAATSARDILSRALDDRPEEGIVRVNREIFTDEEIFELEMKYIFEGNWLFLAHESQIPN
PGDYFTTNIGRQPVVITRSKDGELNCLINACSHRGAMLCRKKVDNRLTITCPFHGWTFSN
DGTLIKVKDEKDGGYPDNFNTDGSHNLRVVPKFESYRGFLFGSLSADVVPLEEHLGDAKV
FLDMLIDQSPEGLEVLKGASTYTFDGNWKLQAENGADGYHVSSTHWNYAATTSRRTTGDS
KNDTKAMDAGKWGEQGGGYFSFPNGHLALWSTWANPEDRPLFDRLDALKELHGEARGEFM
VGASRNLCLYPNVYIMDQFSTQIRRLEPKGVDKTEVTIYCIAPKGESAEARAKRIRQYED
FFNATGMATPDDLEEFRSCQKTYQASSFPWNDMTRGQKQQVEGQNEKAKELGMNTVLSSG
ARTEDEGLYPIQHGYWEEVMLSAIEREESGEAKEVVNDRDSSAATVEKAKQRAAAKAAAA
SERPARRRRRR
Download this sequence
in fasta format
Download all sequences for 1.14.12.13
in fasta format
in csv (Excel, OpenOffice) format