Any feedback?
Please rate this page
(sequences.php)
(0/150)

BRENDA support

Sequence of A0A5B0VN02_9GAMM

EC Number:1.3.3.11

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
pyrroloquinoline-quinone synthase
A0A5B0VN02
Marinobacter salinexigens
251
29165
Reaction
6-(2-amino-2-carboxyethyl)-7,8-dioxo-1,2,3,4,7,8-hexahydroquinoline-2,4-dicarboxylate + 3 O2 = 4,5-dioxo-4,5-dihydro-1H-pyrrolo[2,3-f]quinoline-2,7,9-tricarboxylate + 2 H2O2 + 2 H2O
Other sequences found for EC No. 1.3.3.11

General information:

Sequence
show sequence in normal format
>A0A5B0VN02|pyrroloquinoline-quinone synthase|EC 1.3.3.11|Marinobacter salinexigens|TrEMBL
MNAIANTTMNRQDFEQALRDKGQLYHIHHPYHKAMYGGQCTPEQIRGWVANRYYYQINIP
QKDAAIMANCPDASVRRMWLQRILDHDGHEGDAGGIEAWLCLAEAVGLSREEVIDQRHVL
PGVRFAVDAYLNFARRATWQEAACSSLTELFAPQIHQSRLDSWPQHYPWIEEGGYSYFRK
RLSEARRDVEHGLQITLDHFTTAAQQSRALEILQFKLDILWSMLDSLTMAYMHQTPPYHT
VTDQQVWHRGL
Download this sequence
in fasta format
Download all sequences for 1.3.3.11
in fasta format
in csv (Excel, OpenOffice) format