Any feedback?
Please rate this page
(sequences.php)
(0/150)

BRENDA support

Sequence of A0A6I3A9B0_9ACTN

EC Number:1.3.1.85

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
crotonyl-CoA carboxylase/reductase
A0A6I3A9B0
Actinomycetia bacterium
445
49147
Reaction
(2S)-ethylmalonyl-CoA + NADP+ = (E)-but-2-enoyl-CoA + CO2 + NADPH + H+
Other sequences found for EC No. 1.3.1.85

General information:

Sequence
show sequence in normal format
>A0A6I3A9B0|crotonyl-CoA carboxylase/reductase|EC 1.3.1.85|Actinomycetia bacterium|TrEMBL
MQQIRDAILAGAPGAELAALALPESYRAAVVRRDDIAMFEGVASADKDPRKSVHIQDVAT
PELAPDEAYVAVMASSINFNTVWTSIFEPLPTFGFLERLGKESIWGKRHALPYHVIGSDA
SGVVLRVGSAVRNWKPGDRVTIHCNYVDDQDPSAHNDSMLANNERIWGFETNFGGLADLT
VVKANQLMPKPTHLTWEESAVNALCNSTSYRMLVSDNAARMKQGDTVLIWGATGGIGGYA
VQYVLNGGGVPVGVVSSPEKAQLLNEMGCEAVIDRKAEGYRFWKDEHTQDESEWRRFGKR
VRELAGEDPDIVFEHPGRQTMGASVFSCKRGGTIVTCAATSGYMVEFDNRHFWMKLKKLL
ASHFANYQEAWQANRLIDMGRIQPLLSDVYTLAETGEAARKIHRNEHEGKLGILCLAPTE
GLGIDDPEKRERIGEKKITLFRGRG
Download this sequence
in fasta format
Download all sequences for 1.3.1.85
in fasta format
in csv (Excel, OpenOffice) format