Any feedback?
Please rate this page
(sequences.php)
(0/150)

BRENDA support

Sequence of A0A1B1MKF1_STRLN

EC Number:1.3.1.85

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
crotonyl-CoA carboxylase/reductase
A0A1B1MKF1
Streptomyces lincolnensis
447
49350
Reaction
(2S)-ethylmalonyl-CoA + NADP+ = (E)-but-2-enoyl-CoA + CO2 + NADPH + H+
Other sequences found for EC No. 1.3.1.85

General information:

Sequence
show sequence in normal format
>A0A1B1MKF1|crotonyl-CoA carboxylase/reductase|EC 1.3.1.85|Streptomyces lincolnensis|TrEMBL
MTVKDILDAIQSPESTSADFAALPLPESYRAITVHKDETEMFAGLSTRDKDPRKSIHLDD
VPVPELGPGEALVAVMASSVNYNSVWTSIFEPLSTFGFLERYGRTNDLAKRHDLPYHIIG
SDLAGVVLRTGPGVNAWQPGDEVVAHCLSVELESSDGHNDTMLDPEQRIWGFETNFGGLA
EIALVKSNQLMPKPDHLSWEEAAAPGLVNSTAYRQLVSRNGAGMKQGDNVLIWGASGGLG
SYATQFALAGGANPICVVSSPQKAEICRAMGAEAIIDRTAEDYKFWKDEHHQDPREWKRF
GKRIRELTGGEDVDIVFEHPGRETFGASVYVTRKGGTIVTCASTSGYNHEYDNRYLWMSL
KRIIGSHFANYREAWEANRLIAKGKIHPTLSKVYSMEETGQAAYDVHRNLHQGKVGVLCL
APEEGLGVRDAEKRAQHIDAINRFRNI
Download this sequence
in fasta format
Download all sequences for 1.3.1.85
in fasta format
in csv (Excel, OpenOffice) format
Sequence related references
Sequence Reference
Authors
Title
Journal
Volume
Pages
Year
PubMed ID
2067714
Xu Y.,Tan G.,Ke M.,Li J.,Tang Y.,Meng S.,Niu J.,Wang Y.,Liu R.,Wu H.,Bai L.,Zhang L.,Zhang B.
Enhanced lincomycin production by co-overexpression of metK1 and metK2 in Streptomyces lincolnensis.
J. Ind. Microbiol. Biotechnol.
45
345-355
2018
2067715
Wang R.,Kong F.,Wu H.,Hou B.,Kang Y.,Cao Y.,Duan S.,Ye J.,Zhang H.
Complete genome sequence of high-yield strain S. lincolnensis B48 and identification of crucial mutations contributing to lincomycin overproduction.
Synth Syst Biotechnol
5
37-48
2020