Any feedback?
Please rate this page
(sequences.php)
(0/150)

BRENDA support

Sequence of A9QH69_STRIN

EC Number:1.1.3.2

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
L-lactate oxidase
A9QH69
Streptococcus iniae
390
42384
Reaction
(S)-lactate + O2 = pyruvate + H2O2
Other sequences found for EC No. 1.1.3.2

General information:

Sequence
show sequence in normal format
>A9QH69|L-lactate oxidase|EC 1.1.3.2|Streptococcus iniae|TrEMBL
MENKSEMINATTIEFKTSSAEGSVDFVNVFDLEKMAQKVIPKGAFGYIASGAGDTFTLHE
NIRSFNHKLIVPHGLKGVENPSTEITFDGDKLASPIILAPVAAHKLANEQGEIASAKGVK
EFGTIYTTSSYSTTDLPEISQTLGDSPHWFQFYYSKDDGINRHIMDRLKAEGVKSIVLTV
DATVGGNREVDKRNGFVFPVGMPIVQEYLPNGAGKTMDYVYKATKQALSPKDVEYIAQYS
GLPVYVKGPQCAEDAFRALEAGASGIWVTNHGGRQLDGGPAAFDSLQEVAEAVDRRVPIV
FDSGVRRGQHVFKALASGADLVALGRPVIYGLAMGGSVGTRQVFEKINDELKMVMQLAGT
QTIDDVKHFKLRHNPYDSSIPFSQNALKLD
Download this sequence
in fasta format
Download all sequences for 1.1.3.2
in fasta format
in csv (Excel, OpenOffice) format