Any feedback?
Please rate this page
(sequences.php)
(0/150)

BRENDA support

Sequence of LOX_CHLRE

EC Number:1.1.3.2

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
L-lactate oxidase
F8WQN2
Chlamydomonas reinhardtii
384
41308
Reaction
(S)-lactate + O2 = pyruvate + H2O2
Other sequences found for EC No. 1.1.3.2

General information:

Sequence
show sequence in normal format
>F8WQN2|L-lactate oxidase|EC 1.1.3.2|Chlamydomonas reinhardtii|Swiss-Prot
MADLSFLNLEEVEEEAKKVMPKMAFDYYSTGSDTCYTVGENRSCFSRYLLLPRMLRNVSR
VDTSHELFGIRSSMPVWVAPMAMHGLAHPGREVATCRAAAAAGVPFTFSTVATSSLQEIQ
ETGHDNRIFQLYVIRNREVVRRWVTEAESRGFKALMVTVDAQRLGNREADARNKFTLPPG
LALRNLEYLSSASTVQARDSQDGSGLMKLFTSEVDDSLTWEFIPWLRGVTKLPIIVKGLL
SPADAELAVQYGVDGIVVSNHGGRQLDYAPSGLHMLPAVVAAVRGCGSSIPVLVDGGVRR
GTDVIKALALGASGVLLGRPVLYGLAVGGQAGVERVLQLLRSEIELSMALAGCSSVQQIG
PQLLLPAPSAGPAPPMPAAQLCKL
Download this sequence
in fasta format
Download all sequences for 1.1.3.2
in fasta format
in csv (Excel, OpenOffice) format
Sequence related references
Sequence Reference
Authors
Title
Journal
Volume
Pages
Year
PubMed ID
1208954
Hackenberg C.,Kern R.,Huge J.,Stal L.J.,Tsuji Y.,Kopka J.,Shiraiwa Y.,Bauwe H.,Hagemann M.
Cyanobacterial lactate oxidases serve as essential partners in N2 fixation and evolved into photorespiratory glycolate oxidases in plants.
Plant Cell
23
2978-2990
2011
1208955
Merchant S.S.,Prochnik S.E.,Vallon O.,Harris E.H.,Karpowicz S.J.,Witman G.B.,Terry A.,Salamov A.,Fritz-Laylin L.K.,Marechal-Drouard L.,Marshall W.F.,Qu L.H.,Nelson D.R.,Sanderfoot A.A.,Spalding M.H.,Kapitonov V.V.,Ren Q.,Ferris P.,Lindquist E.,Shapiro H.,Lucas S.M.,Grimwood J.,Schmutz J.,Cardol P.,Cerutti H.,Chanfreau G.,Chen C.L.,Cognat V.,Croft M.T.,Dent R.,Dutcher S.,Fernandez E.,Fukuzawa H.,Gonzalez-Ballester D.,Gonzalez-Halphen D.,Hallmann A.,Hanikenne M.,Hippler M.,Inwood W.,Jabbari K.,Kalanon M.,Kuras R.,Lefebvre P.A.,Lemaire S.D.,Lobanov A.V.,Lohr M.,Manuell A.,Meier I.,Mets L.,Mittag M.,Mittelmeier T.,Moroney J.V.,Moseley J.,Napoli C.,Nedelcu A.M.,Niyogi K.,Novoselov S.V.,Paulsen I.T.,Pazour G.J.,Purton S.,Ral J.P.,Riano-Pachon D.M.,Riekhof W.,Rymarquis L.,Schroda M.,Stern D.,Umen J.,Willows R.,Wilson N.,Zimmer S.L.,Allmer J.,Balk J.,Bisova K.,Chen C.J.,Elias M.,Gendler K.,Hauser C.,Lamb M.R.,Ledford H.,Long J.C.,Minagawa J.,Page M.D.,Pan J.,Pootakham W.,Roje S.,Rose A.,Stahlberg E.,Terauchi A.M.,Yang P.,Ball S.,Bowler C.,Dieckmann C.L.,Gladyshev V.N.,Green P.,Jorgensen R.,Mayfield S.,Mueller-Roeber B.,Rajamani S.,Sayre R.T.,Brokstein P.,Dubchak I.,Goodstein D.,Hornick L.,Huang Y.W.,Jhaveri J.,Luo Y.,Martinez D.,Ngau W.C.,Otillar B.,Poliakov A.,Porter A.,Szajkowski L.,Werner G.,Zhou K.,Grigoriev I.V.,Rokhsar D.S.,Grossman A.R.
The Chlamydomonas genome reveals the evolution of key animal and plant functions.
Science
318
245-250
2007