Any feedback?
Please rate this page
(sequences.php)
(0/150)

BRENDA support

Sequence of FRO2_ARATH

EC Number:1.16.1.10

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
ferric-chelate reductase [NAD(P)H]
P92949
Arabidopsis thaliana
725
81501
Reaction
2 Fe(II)-siderophore + NAD(P)+ + H+ = 2 Fe(III)-siderophore + NAD(P)H
Other sequences found for EC No. 1.16.1.10

General information:

Sequence
show sequence in normal format
>P92949|ferric-chelate reductase [NAD(P)H]|EC 1.16.1.10|Arabidopsis thaliana|Swiss-Prot
MEIEKSNNGGSNPSAGEEFKDMIKGVTKFLMMVIFLGTIMLWIMMPTLTYRTKWLPHLRI
KFGTSTYFGATGTTLFMYMFPMMVVACLGCVYLHFKNRKSPHHIDRETKGGVWSKLRKPM
LVKGPLGIVSVTEITFLAMFVALLLWCFITYLRNSFATITPKSAAAHDESLWQAKLESAA
LRLGLIGNICLAFLFLPVARGSSLLPAMGLTSESSIKYHIWLGHMVMALFTVHGLCYIIY
WASMHEISQMIMWDTKGVSNLAGEIALAAGLVMWATTYPKIRRRFFEVFFYTHYLYIVFM
LFFVLHVGISFSFIALPGFYIFLVDRFLRFLQSRENVRLLAARILPSDTMELTFSKNSKL
VYSPTSIMFVNIPSISKLQWHPFTITSSSKLEPEKLSIVIKKEGKWSTKLHQRLSSSDQI
DRLAVSVEGPYGPASADFLRHEALVMVCGGSGITPFISVIRDLIATSQKETCKIPKITLI
CAFKKSSEISMLDLVLPLSGLETELSSDINIKIEAFITRDNDAGDEAKAGKIKTLWFKPS
LSDQSISSILGPNSWLWLGAILASSFLIFMIIIGIITRYYIYPIDHNTNKIYSLTSKTII
YILVISVSIMATCSAAMLWNKKKYGKVESKQVQNVDRPSPTSSPTSSWGYNSLREIESTP
QESLVQRTNLHFGERPNLKKLLLDVEGSSVGVLVCGPKKMRQKVAEICSSGLAENLHFES
ISFSW
Download this sequence
in fasta format
Download all sequences for 1.16.1.10
in fasta format
in csv (Excel, OpenOffice) format
Sequence related references
Sequence Reference
Authors
Title
Journal
Volume
Pages
Year
PubMed ID
1188460
Robinson N.J.,Procter C.M.,Connolly E.L.,Guerinot M.L.
A ferric-chelate reductase for iron uptake from soils.
Nature
397
694-697
1999
1188462
Wu H.,Li L.,Du J.,Yuan Y.,Cheng X.,Ling H.Q.
Molecular and biochemical characterization of the Fe(III) chelate reductase gene family in Arabidopsis thaliana.
Plant Cell Physiol.
46
1505-1514
2005
1188463
Theologis A.,Ecker J.R.,Palm C.J.,Federspiel N.A.,Kaul S.,White O.,Alonso J.,Altafi H.,Araujo R.,Bowman C.L.,Brooks S.Y.,Buehler E.,Chan A.,Chao Q.,Chen H.,Cheuk R.F.,Chin C.W.,Chung M.K.,Conn L.,Conway A.B.,Conway A.R.,Creasy T.H.,Dewar K.,Dunn P.,Etgu P.,Feldblyum T.V.,Feng J.-D.,Fong B.,Fujii C.Y.,Gill J.E.,Goldsmith A.D.,Haas B.,Hansen N.F.,Hughes B.,Huizar L.,Hunter J.L.,Jenkins J.,Johnson-Hopson C.,Khan S.,Khaykin E.,Kim C.J.,Koo H.L.,Kremenetskaia I.,Kurtz D.B.,Kwan A.,Lam B.,Langin-Hooper S.,Lee A.,Lee J.M.,Lenz C.A.,Li J.H.,Li Y.-P.,Lin X.,Liu S.X.,Liu Z.A.,Luros J.S.,Maiti R.,Marziali A.,Militscher J.,Miranda M.,Nguyen M.,Nierman W.C.,Osborne B.I.,Pai G.,Peterson J.,Pham P.K.,Rizzo M.,Rooney T.,Rowley D.,Sakano H.,Salzberg S.L.,Schwartz J.R.,Shinn P.,Southwick A.M.,Sun H.,Tallon L.J.,Tambunga G.,Toriumi M.J.,Town C.D.,Utterback T.,Van Aken S.,Vaysberg M.,Vysotskaia V.S.,Walker M.,Wu D.,Yu G.,Fraser C.M.,Venter J.C.,Davis R.W.
Sequence and analysis of chromosome 1 of the plant Arabidopsis thaliana.
Nature
408
816-820
2000
1188464
Cheng C.Y.,Krishnakumar V.,Chan A.P.,Thibaud-Nissen F.,Schobel S.,Town C.D.
Araport11: a complete reannotation of the Arabidopsis thaliana reference genome.
Plant J.
89
789-804
2017
1188465
Vert G.A.,Briat J.F.,Curie C.
Dual regulation of the Arabidopsis high-affinity root iron uptake system by local and long-distance signals.
Plant Physiol.
132
796-804
2003
1188466
Connolly E.L.,Campbell N.H.,Grotz N.,Prichard C.L.,Guerinot M.L.
Overexpression of the FRO2 ferric chelate reductase confers tolerance to growth on low iron and uncovers posttranscriptional control.
Plant Physiol.
133
1102-1110
2003
1188467
Mukherjee I.,Campbell N.H.,Ash J.S.,Connolly E.L.
Expression profiling of the Arabidopsis ferric chelate reductase (FRO) gene family reveals differential regulation by iron and copper.
Planta
223
1178-1190
2006
1188468
Durrett T.P.,Connolly E.L.,Rogers E.E.
Arabidopsis cpFtsY mutants exhibit pleiotropic defects including an inability to increase iron deficiency-inducible root Fe(III) chelate reductase activity.
Plant J.
47
467-479
2006
1188469
Schagerloef U.,Wilson G.,Hebert H.,Al-Karadaghi S.,Haegerhaell C.
Transmembrane topology of FRO2, a ferric chelate reductase from Arabidopsis thaliana.
Plant Mol. Biol.
62
215-221
2006
1188470
Seguela M.,Briat J.-F.,Vert G.,Curie C.
Cytokinins negatively regulate the root iron uptake machinery in Arabidopsis through a growth-dependent pathway.
Plant J.
55
289-300
2008
1188471
Einset J.,Winge P.,Bones A.M.,Connolly E.L.
The FRO2 ferric reductase is required for glycine betaine's effect on chilling tolerance in Arabidopsis roots.
Physiol. Plantarum
134
334-341
2008
1188473
Kong W.W.,Zhang L.P.,Guo K.,Liu Z.P.,Yang Z.M.
Carbon monoxide improves adaptation of Arabidopsis to iron deficiency.
Plant Biotechnol. J.
8
88-99
2010