Any feedback?
Please rate this page
(sequences.php)
(0/150)

BRENDA support

Sequence of B9SBP0_RICCO

EC Number:1.14.14.105

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
taxane 10beta-hydroxylase
B9SBP0
Ricinus communis
455
52235
Reaction
taxa-4(20),11-dien-5alpha-yl acetate + [reduced NADPH-hemoprotein reductase] + O2 = 10beta-hydroxytaxa-4(20),11-dien-5alpha-yl acetate + [oxidized NADPH-hemoprotein reductase] + H2O
Other sequences found for EC No. 1.14.14.105

General information:

Sequence
show sequence in normal format
>B9SBP0|taxane 10beta-hydroxylase|EC 1.14.14.105|Ricinus communis|TrEMBL
MELVMFPVLALVSTLFLLALHFIIRTLKERLFGSPNLPPGRLGWPLIGETPAFFRAGFEA
KPEKFIGERMEKYDSRVFKTSLLGKPFAVISGTAGHKFLFSNENKLVNLWWPESVRMLFK
SALVSVVGDEAKRIRKMLMTFLGLDALKNYTERIDMVTQQHIRTYWEGKEEVTVYSTLKL
YTFTLACNLFASINDPERLSKLGAHFDVFVKGVISLPISIPGTRLYKSMKAANAIREELK
LIVRDRKEALERKMASPTQDLLSYLLVDSDTNGRFLSEMEILDNIMLLLYAEQLEIANSK
KPGELLQWEDVQKMRYSWNVISEVLRLSPPVSSAYRHAIVDFTYEGYTIPKGWQLFTSFG
TTHRDPALFPNPERFDASRFEGNGPPSYSYIPFGGGPRMCIGYEFARLEMLIFLHNIIKR
FKWDILIPDEQFGYNPLLAPSQGFPVRLRPHHSHL
Download this sequence
in fasta format
Download all sequences for 1.14.14.105
in fasta format
in csv (Excel, OpenOffice) format
Sequence related references
Sequence Reference
Authors
Title
Journal
Volume
Pages
Year
PubMed ID
27339306
Chan A.P.,Crabtree J.,Zhao Q.,Lorenzi H.,Orvis J.,Puiu D.,Melake-Berhan A.,Jones K.M.,Redman J.,Chen G.,Cahoon E.B.,Gedil M.,Stanke M.,Haas B.J.,Wortman J.R.,Fraser-Liggett C.M.,Ravel J.,Rabinowicz P.D.
Draft genome sequence of the oilseed species Ricinus communis.
Nat. Biotechnol.
28
951-956
2010