Sequence of A0A4U9SNL8_CLODI

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
S-(hydroxymethyl)mycothiol dehydrogenase
A0A4U9SNL8
Clostridioides difficile
372
38872
Reaction
S-(hydroxymethyl)mycothiol + NAD+ = S-formylmycothiol + NADH + H+
Sequences with same EC No.
Sequence
show sequence in normal format
>A0A4U9SNL8|S-(hydroxymethyl)mycothiol dehydrogenase|EC 1.1.1.306|Clostridioides difficile|TrEMBL
MSRTVRGAVIDAIGGKWKVEDLDLAEPGPGEVRIKVMASGLCHSDDHLVTGDIPNALPMV
GGHEGAGIVDAVGPGVRRLAVGDHVATAYLPACGRCRWCSQGMQYICDTGAGMENGFGLE
GNPRFSRTSGQPIGAMQRLGTFADHLVTDESQAVKIDDDLPFDIACLVSCGVATGWGAAV
NAAHVRPRETAMIIGAGGVGMNAVQGAHHAGAAYVVAVDPVDFKREQAMKLGATHAFASI
AEAVPFVESVTNGQGADSAVITVGVVDGALIAEAFSAVRKEGRVALVSIGQNEPGIPISP
LEIVTYAKTIRGVLFGNCNPTSDIPALLDYYKAGQLKLDELITARYTIDQINEAYVDMHA
GKNLRGVLIHEH
Download this sequence
in fasta format
Download all sequences for 1.1.1.306
in fasta format
in csv (Excel, OpenOffice) format