Sequence of A0A1E5CG04_9GAMM

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
glycine C-acetyltransferase
A0A1E5CG04
Enterovibrio norvegicus FF-454
398
43254
Reaction
acetyl-CoA + glycine = CoA + L-2-amino-3-oxobutanoate
Sequences with same EC No.
Sequence
show sequence in normal format
>A0A1E5CG04|glycine C-acetyltransferase|EC 2.3.1.29|Enterovibrio norvegicus FF-454|TrEMBL
MTAAFYQQIRQQLEETKAEGLYKDERVITSAQQASISVTSGAEVLNFCANNYLGLANHPT
LIDAAQKGMDQHGFGMASVRFICGTQDAHKELEEKLSTFLGMEDTILYTSCFDANTGLFE
TILGAEDAIISDALNHASIIDGVRLCKAMRFRYANNNMEELEQQLIAAKEAGARNTLIVT
DGVFSMDGVVANLPAICDLADKYGALVMVDDSHAVGFMGANGRGTHEHHDVIERIDIITG
TLGKAMGGASGGYTSGKKEVIDWLRQRSRPYLFSNSLAPAIVSASIRVIDLLEESGNLRT
QLWENASHFRARMSEAGFTLSGADHAIIPVMLGDAKVGAEFAERMMEEGIYVVGFSFPVV
PKGQARIRTQMSAAHSREQLDKAIDAFIKVGKDMGLIE
Download this sequence
in fasta format
Download all sequences for 2.3.1.29
in fasta format
in csv (Excel, OpenOffice) format
Sequence related references
Sequence Reference
Authors
Title
Journal
Volume
Pages
Year
PubMed ID
2835319
Cordero O.X.,Wildschutte H.,Kirkup B.,Proehl S.,Ngo L.,Hussain F.,Le Roux F.,Mincer T.,Polz M.F.
Ecological populations of bacteria act as socially cohesive units of antibiotic production and resistance.
Science
337
1228-1231
2012