Sequence of LPXH_NEIMA

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
UDP-2,3-diacylglucosamine diphosphatase
Q9JVS0
Neisseria meningitidis serogroup A / serotype 4A (strain Z2491)
240
27697
Reaction
UDP-2-N,3-O-bis[(3R)-3-hydroxytetradecanoyl]-alpha-D-glucosamine + H2O = 2-N,3-O-bis[(3R)-3-hydroxytetradecanoyl ]-alpha-D-glucosaminyl 1-phosphate + UMP
Sequences with same EC No.
Sequence
show sequence in normal format
>Q9JVS0|UDP-2,3-diacylglucosamine diphosphatase|EC 3.6.1.54|Neisseria meningitidis serogroup A / serotype 4A (strain Z2491)|Swiss-Prot
MKPAYFISDLHLSEKHPELTALLLRFLRSSAAGQARAIYILGDLFDFWVGDDEVSELNTS
VAREIRKLSDKGVAVFFVRGNRDFLIGQDFCRQAGMTLLPDYSVLDLFGCKTLICHGDTL
CTDDRAYQRFRKIVHRKRLQKLFLMLPLKWRTRLAAKIRRVSKMEKQVKPADIMDVNAAF
TARQVRAFNAERLIHGHTHREHIHHENGFTRIVLGDWHNDYASILRVDGDGAVFVPLEKY
Download this sequence
in fasta format
Download all sequences for 3.6.1.54
in fasta format
in csv (Excel, OpenOffice) format
Sequence related references
Sequence Reference
Authors
Title
Journal
Volume
Pages
Year
PubMed ID
178236
Parkhill J.,Achtman M.,James K.D.,Bentley S.D.,Churcher C.M.,Klee S.R.,Morelli G.,Basham D.,Brown D.,Chillingworth T.,Davies R.M.,Davis P.,Devlin K.,Feltwell T.,Hamlin N.,Holroyd S.,Jagels K.,Leather S.,Moule S.,Mungall K.L.,Quail M.A.,Rajandream M.A.,Rutherford K.M.,Simmonds M.,Skelton J.,Whitehead S.,Spratt B.G.,Barrell B.G.
Complete DNA sequence of a serogroup A strain of Neisseria meningitidis Z2491.
Nature
404
502-506
2000