Sequence of NCPR_ASPNG

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
NADPH-hemoprotein reductase
Q00141
Aspergillus niger
694
76807
Reaction
NADPH + H+ + n oxidized hemoprotein = NADP+ + n reduced hemoprotein
Sequences with same EC No.
Sequence
show sequence in normal format
>Q00141|NADPH-hemoprotein reductase|EC 1.6.2.4|Aspergillus niger|Swiss-Prot
MAQLDTLDLVVLAVLLVGSVAYFTKGTYWAVAKDPYASTGPAMNGAAKAGKTRNIIEKME
ETGKNCVIFYGSQTGTAEDYASRLAKEGSQRFGLKTMVADLEEYDYENLDQFPEDKVAFF
VLATYGEGEPTDNAVEFYQFFTGDDVAFESASADEKPLSKLKYVAFGLGNNTYEHYNAMV
RQVDAAFQKLGPQRIGSAGEGDDGAGTMEEDFLAWKEPMWAALSESMDLEEREAVYEPVF
CVTENESLSPEDETVYLGEPTQSHLQGTPKGPYSAHNPFIAPIAESRELFTVKDRNCLHM
EISIAGSNLSYQTGDHIAVWPTNAGAEVDRFLQVFGLEGKRDSVINIKGIDVTAKVPIPT
PTTYDAAVRYYMEVCAPVSRQFVATLAAFAPDEESKAEIVRLGSHKDYFHEKVTNQCFNM
AQALQSITSKPFSAVPFSLLIEGITKLQPRYYSISSSSLVQKDKISITAVVESVRLPGAS
HMVKGVTTNYLLALKQKQNGDPSPDPHGLTYSITGPRNKYDGIHVPVHVRHSNFKLPSDP
SRPIIMVGPGTGVAPFRGFIQERAALAAKGEKVGPTVLFFGCRKSDEDFLYKDEWKTYQD
QLGDNLKIITAFSREGPQKVYVQHRLREHSELVSDLLKQKATFYVCGDAANMAREVNLVL
GQIIAAQRGLPAEKGEEMVKHMRRRGRYQEDVWS
Download this sequence
in fasta format
Download all sequences for 1.6.2.4
in fasta format
in csv (Excel, OpenOffice) format
Sequence related references
Sequence Reference
Authors
Title
Journal
Volume
Pages
Year
PubMed ID
183365
van den Brink H.J.M.,van Zeijl C.M.J.,Brons J.F.,van den Hondel C.A.M.J.J.,van Gorcom R.F.M.
Cloning and characterization of the NADPH cytochrome P450 oxidoreductase gene from the filamentous fungus Aspergillus niger.
DNA Cell Biol.
14
719-729
1995
183366
Faber B.W.,van Gorcom R.F.M.,Duine J.A.
Purification and characterization of benzoate-para-hydroxylase, a cytochrome P450 (CYP53A1), from Aspergillus niger.
Arch. Biochem. Biophys.
394
245-254
2001