Sequence of MBOA5_DROME

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
1-acylglycerophosphocholine O-acyltransferase
Q9VVX5
Drosophila melanogaster
497
57394
Reaction
acyl-CoA + 1-acyl-sn-glycero-3-phosphocholine = CoA + 1,2-diacyl-sn-glycero-3-phosphocholine
Sequences with same EC No.
Sequence
show sequence in normal format
>Q9VVX5|1-acylglycerophosphocholine O-acyltransferase|EC 2.3.1.23|Drosophila melanogaster|Swiss-Prot
MAEFEEDLPHNGLMDGIASGVGVPVEALRLLLTILAGYPVAALYQKFISVIADKTVHHMF
FAGCGAGLCYFNYGLDTYHSLIAILTTYFLVLLLRKKTQIFLAINFVFHMSYLLLGYFYT
SSNDYDILWTMPHCILVLRMIGYGFDITDGLKEESELSKDQKETALKKPPSLLELLAFSY
FPSGFLVGPQFPFRRYKAFVDGEFRQHEGNVEAGVRRFGAGAFYLIVCQVGLRYLPDSYF
LTPEFAQVSFVKRIYLLGFWAKFSLYKYISCWLLTEGALICIGLTYKGEDKNGQPDWSGC
SNVKLKLLETGNTMEHYVQSFNVNTNQWVGQYIYKRLKFLNNRTISYGAALGFLAVWHGY
HSGYYMTFLMEYMVVSTEKQITRFYTKVVLPQWGHILNNSDIYKLLYFITLKSYNVVYMG
WCLTAFVFLKYERWIVVYGAVSYYGFTFLVLWAAFYHTFNHFFRSSSRKLAGEDQKLQDS
NTDKLVEEKKPEDKKSE
Download this sequence
in fasta format
Download all sequences for 2.3.1.23
in fasta format
in csv (Excel, OpenOffice) format
Sequence related references
Sequence Reference
Authors
Title
Journal
Volume
Pages
Year
PubMed ID
179226
Maurel-Zaffran C.,Chauvet S.,Jullien N.,Miassod R.,Pradel J.,Aragnol D.
nessy, an evolutionary conserved gene controlled by Hox proteins during Drosophila embryogenesis.
Mech. Dev.
86
159-163
1999
179227
Adams M.D.,Celniker S.E.,Holt R.A.,Evans C.A.,Gocayne J.D.,Amanatides P.G.,Scherer S.E.,Li P.W.,Hoskins R.A.,Galle R.F.,George R.A.,Lewis S.E.,Richards S.,Ashburner M.,Henderson S.N.,Sutton G.G.,Wortman J.R.,Yandell M.D.,Zhang Q.,Chen L.X.,Brandon R.C.,Rogers Y.-H.C.,Blazej R.G.,Champe M.,Pfeiffer B.D.,Wan K.H.,Doyle C.,Baxter E.G.,Helt G.,Nelson C.R.,Miklos G.L.G.,Abril J.F.,Agbayani A.,An H.-J.,Andrews-Pfannkoch C.,Baldwin D.,Ballew R.M.,Basu A.,Baxendale J.,Bayraktaroglu L.,Beasley E.M.,Beeson K.Y.,Benos P.V.,Berman B.P.,Bhandari D.,Bolshakov S.,Borkova D.,Botchan M.R.,Bouck J.,Brokstein P.,Brottier P.,Burtis K.C.,Busam D.A.,Butler H.,Cadieu E.,Center A.,Chandra I.,Cherry J.M.,Cawley S.,Dahlke C.,Davenport L.B.,Davies P.,de Pablos B.,Delcher A.,Deng Z.,Mays A.D.,Dew I.,Dietz S.M.,Dodson K.,Doup L.E.,Downes M.,Dugan-Rocha S.,Dunkov B.C.,Dunn P.,Durbin K.J.,Evangelista C.C.,Ferraz C.,Ferriera S.,Fleischmann W.,Fosler C.,Gabrielian A.E.,Garg N.S.,Gelbart W.M.,Glasser K.,Glodek A.,Gong F.,Gorrell J.H.,Gu Z.,Guan P.,Harris M.,Harris N.L.,Harvey D.A.,Heiman T.J.,Hernandez J.R.,Houck J.,Hostin D.,Houston K.A.,Howland T.J.,Wei M.-H.,Ibegwam C.,Jalali M.,Kalush F.,Karpen G.H.,Ke Z.,Kennison J.A.,Ketchum K.A.,Kimmel B.E.,Kodira C.D.,Kraft C.L.,Kravitz S.,Kulp D.,Lai Z.,Lasko P.,Lei Y.,Levitsky A.A.,Li J.H.,Li Z.,Liang Y.,Lin X.,Liu X.,Mattei B.,McIntosh T.C.,McLeod M.P.,McPherson D.,Merkulov G.,Milshina N.V.,Mobarry C.,Morris J.,Moshrefi A.,Mount S.M.,Moy M.,Murphy B.,Murphy L.,Muzny D.M.,Nelson D.L.,Nelson D.R.,Nelson K.A.,Nixon K.,Nusskern D.R.,Pacleb J.M.,Palazzolo M.,Pittman G.S.,Pan S.,Pollard J.,Puri V.,Reese M.G.,Reinert K.,Remington K.,Saunders R.D.C.,Scheeler F.,Shen H.,Shue B.C.,Siden-Kiamos I.,Simpson M.,Skupski M.P.,Smith T.J.,Spier E.,Spradling A.C.,Stapleton M.,Strong R.,Sun E.,Svirskas R.,Tector C.,Turner R.,Venter E.,Wang A.H.,Wang X.,Wang Z.-Y.,Wassarman D.A.,Weinstock G.M.,Weissenbach J.,Williams S.M.,Woodage T.,Worley K.C.,Wu D.,Yang S.,Yao Q.A.,Ye J.,Yeh R.-F.,Zaveri J.S.,Zhan M.,Zhang G.,Zhao Q.,Zheng L.,Zheng X.H.,Zhong F.N.,Zhong W.,Zhou X.,Zhu S.C.,Zhu X.,Smith H.O.,Gibbs R.A.,Myers E.W.,Rubin G.M.,Venter J.C.
The genome sequence of Drosophila melanogaster.
Science
287
2185-2195
2000
179228
Misra S.,Crosby M.A.,Mungall C.J.,Matthews B.B.,Campbell K.S.,Hradecky P.,Huang Y.,Kaminker J.S.,Millburn G.H.,Prochnik S.E.,Smith C.D.,Tupy J.L.,Whitfield E.J.,Bayraktaroglu L.,Berman B.P.,Bettencourt B.R.,Celniker S.E.,de Grey A.D.N.J.,Drysdale R.A.,Harris N.L.,Richter J.,Russo S.,Schroeder A.J.,Shu S.Q.,Stapleton M.,Yamada C.,Ashburner M.,Gelbart W.M.,Rubin G.M.,Lewis S.E.
Annotation of the Drosophila melanogaster euchromatic genome: a systematic review.
Genome Biol.
3
0-0
2002
179229
Stapleton M.,Carlson J.W.,Brokstein P.,Yu C.,Champe M.,George R.A.,Guarin H.,Kronmiller B.,Pacleb J.M.,Park S.,Wan K.H.,Rubin G.M.,Celniker S.E.
A Drosophila full-length cDNA resource.
Genome Biol.
3
0-0
2002
179230
Zhai B.,Villen J.,Beausoleil S.A.,Mintseris J.,Gygi S.P.
Phosphoproteome analysis of Drosophila melanogaster embryos.
J. Proteome Res.
7
1675-1682
2008
179231
Steinhauer J.,Gijon M.A.,Riekhof W.R.,Voelker D.R.,Murphy R.C.,Treisman J.E.
Drosophila lysophospholipid acyltransferases are specifically required for germ cell development.
Mol. Biol. Cell
20
5224-5235
2009