Sequence of A0A2X3VWR4_STRSA

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
glycerol-3-phosphate oxidase
A0A2X3VWR4
Streptococcus sanguinis
608
66863
Reaction
sn-glycerol 3-phosphate + O2 = glycerone phosphate + H2O2
Sequences with same EC No.
Sequence
show sequence in normal format
>A0A2X3VWR4|glycerol-3-phosphate oxidase|EC 1.1.3.21|Streptococcus sanguinis|TrEMBL
MEFSKKTRELSIKKMQERTLDLLIIGGGITGAGVALQAAASGLETGLIEMQDFAEGTSSR
STKLVHGGLRYLKQFDVEVVSDTVSERAVVQQIAPHIPKPDPMLLPVYEEEGATFSLFRL
KVAMDLYDLLAGVNNTPAANKVLSKEEVLEREPELKKEGLVGGGVYLDFRNNDARLVIEN
IKRANQDGALIANHVKAEGFLFDDSGKITGVVARDLLTDEVFEIKARLVINTTGPWSDSV
RNLSNDGEQYSQMRPTKGVHLVVDSSKIKVSQPVYFDTGLGDGRMVFVLPRENKTYFGTT
DTDYTGDLEHPKVTQEDVDYLLGIVNNRFPEANITIDDIESSWAGLRPLIAGNSASDYNG
GNNGTISDESFNELIATVESYLAKEKSREDVESAVTQLESSTSEKHLDPSAVSRGSSLEH
DNNGLLTLAGGKITDYRKMAEGAMERVVEILKAEFDRSFKLINSKTYPVSGGELNPANVD
SEIEAFAQLGVSRGLDSKEAFYLANLYGSNAPKVFALAHSIEQAPGLSLADTLSLHYAMR
NELALSPVDFLLRRTNHMLFMRDGLDAIVEPVLDEMGRFYDWTEEEKAAYRNDVQAALAN
NDLEELKK
Download this sequence
in fasta format
Download all sequences for 1.1.3.21
in fasta format
in csv (Excel, OpenOffice) format