Sequence of A0A3G5RWR6_9GAMM

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
benzoate 1,2-dioxygenase
A0A3G5RWR6
Acinetobacter sp. FDAARGOS_493
460
52345
Reaction
benzoate + NADH + H+ + O2 = (1R,6S)-1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate + NAD+
Sequences with same EC No.
Sequence
show sequence in normal format
>A0A3G5RWR6|benzoate 1,2-dioxygenase|EC 1.14.12.10|Acinetobacter sp. FDAARGOS_493|TrEMBL
MPRIPVINTSHLDRIDELLVDNIDTGEFKLHRSVFTDEALFDLEMKYIFEGNWVYLAHES
QIPNNNDYYTTYIGRQPIIIARNRNGELNAMINACSHRGAQLCRYKRGNKATYTCPFHGW
TFNNSGKLLKVKDPTDAGYSDCFNQDGSHDLKKVARFESYKGFLFGSLNPDVPSLEEFLG
ETTKIIDMIVDQSEHGLEVLRGSSTYTYEGNWKLTAENGADGYHVSAVHWNYAATTQHRK
ETQAADNIRAMSAGSWGKQGGGSYGFENGHMLLWTQWANPEDRPNFPKADEYTEKYGEAM
SKWMIERSRNLCLYPNVYLMDQFGSQIRVLRPLSVNRTEVTIYCIAPKGEAPEARARRIR
QYEDFFNASGMATPDDLEEFRACQAGYAGIALEWNDMCRGSKHWIYGPDDAANEIGLKPM
LSGIKTEDEGLYLAQHQYWLKTMKHAIATEKEIADQGETA
Download this sequence
in fasta format
Download all sequences for 1.14.12.10
in fasta format
in csv (Excel, OpenOffice) format