Any feedback?
Please rate this page
(sequences.php)
(0/150)

BRENDA support

Sequence of A0A396HJ99_MEDTR

EC Number:1.14.14.83

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
geraniol 8-hydroxylase
A0A396HJ99
Medicago truncatula
475
53857
Reaction
geraniol + [reduced NADPH-hemoprotein reductase] + O2 = (6E)-8-hydroxygeraniol + [oxidized NADPH-hemoprotein reductase] + H2O
Other sequences found for EC No. 1.14.14.83

General information:

Sequence
show sequence in normal format
>A0A396HJ99|geraniol 8-hydroxylase|EC 1.14.14.83|Medicago truncatula|TrEMBL
MATIPYMDILSYILIFLLIFIVTQVFYSLFATKMRNKTNSKLPPGPFPLPIVGNLFVMNN
KPHKSLAKLAKIYGPILTLKLGQVTTIVISSPDMAKEILQTHDSLLSDRTVPHALTAFNH
DQFGVGFLSLSPLWREMRRVCKNQLFSNKSLDASQYLRRGKIDELINYVSQCSLKDFANN
KDLVMDMSETVGSPNMADFFPLLRLIDPQGIKRTYVFYVGKLFGIFDNIIDQKLKLREGD
GFVANNDMLDSLLAEENKKELDREKIQHLLHDLLVGGTDTTTYTLEWAMAELLHNPNIMS
KVKKELEDTIGIGNPIEESDVARLPYLQAIIKETLRLHPIAPLLLPRKAKEDVEVNGYLI
PKGAQIFVNVWAIGRDPKVWDNPNLFSPKRFLGTKLDIKGQNFQLTPFGSGRRICPGLPL
AMRMLHMMLGSLLISFDWKLENDMKPEEIDMEDAIQGLALRKCESLRVIPTKISN
Download this sequence
in fasta format
Download all sequences for 1.14.14.83
in fasta format
in csv (Excel, OpenOffice) format